Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetE3 ubiquitin-protein ligase Mdm2
LigandBDBM162130
Substrate/Competitorn/a
Meas. Tech.Time Resolved Fluorescence Energy Transfer (TR-FRET) Assay
IC50 1.4±n/a nM
Citation Berghausen JBuschmann NFuret PGessier FHergovich Lisztwan JHolzer PJacoby EKallen JMasuya KPissot Soldermann CRen HStutz S Substituted isoquinolinones and quinazolinones US Patent  US9051279 Publication Date 6/9/2015
More Info.:Get all data from this article,  Assay Method
 
E3 ubiquitin-protein ligase Mdm2
Name:MDM2-MDMX
Synonyms:Double minute 2 protein | Double minute 2 protein (HDM2) | E3 ubiquitin-protein ligase Mdm2 (p53-binding protein Mdm2) | Hdm2 | Human Double Minute 2 (HDM2) | p53-Binding Protein MDM2 | p53-binding protein
Type:Oncoprotein
Mol. Mass.:55196.54
Organism:Homo sapiens (Human)
Description:n/a
Residue:491
Sequence:
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMTKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSENRCHLEGGSDQKDLVQELQEEKPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSGDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYQVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCNEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVP
DCKKTIVNDSRESCVEENDDKITQASQSQESEDYSQPSTSSSIIYSSQEDVKEFEREETQ
DKEESVESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM162130
n/a
NameBDBM162130
Synonyms:US9051279, 113
TypeSmall organic molecule
Emp. Form.C39H49ClN4O4
Mol. Mass.673.284
SMILESCOc1cc2CC(=O)N([C@@H](c3ccc(Cl)cc3)c2cc1OC(C)C)c1ccc(cc1)N(C)C[C@H]1CC[C@@H](CC1)N1CCN(CC1)C(C)=O |r,wU:33.36,wD:9.9,36.43,(8,.38,;6.67,1.15,;5.33,.38,;4,1.15,;2.67,.38,;1.33,1.15,;,.38,;-1.33,1.15,;,-1.15,;1.33,-1.93,;1.33,-3.47,;,-4.23,;,-5.78,;1.33,-6.54,;1.33,-8.08,;2.67,-5.78,;2.67,-4.23,;2.67,-1.15,;4,-1.93,;5.33,-1.15,;6.67,-1.93,;6.67,-3.47,;8,-4.23,;5.33,-4.23,;-1.33,-1.93,;-2.67,-1.15,;-4,-1.93,;-4,-3.47,;-2.67,-4.23,;-1.33,-3.47,;-5.33,-4.23,;-5.33,-5.78,;-6.67,-3.47,;-6.67,-1.93,;-8,-1.15,;-8,.38,;-6.67,1.15,;-5.33,.38,;-5.33,-1.15,;-6.67,2.69,;-5.33,3.47,;-5.33,5,;-6.67,5.78,;-8,5,;-8,3.47,;-6.67,7.31,;-8,8.08,;-5.33,8.08,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: