Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-glucuronidase (SaGUS)
LigandBDBM163637
Substrate/Competitorn/a
Meas. Tech.Inhibition Assays
Ki 3.0e+3± 1e+3 nM
Citation Wallace BDRoberts ABPollet RMIngle JDBiernat KAPellock SJVenkatesh MKGuthrie LO'Neal SKRobinson SJDollinger MFigueroa EMcShane SRCohen RDJin JFrye SVZamboni WCPepe-Ranney CMani SKelly LRedinbo MR Structure and Inhibition of Microbiome -Glucuronidases Essential to the Alleviation of Cancer Drug Toxicity. Chem Biol 22:1238-49 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-glucuronidase (SaGUS)
Name:Beta-glucuronidase (SaGUS)
Synonyms:n/a
Type:Protein
Mol. Mass.:69235.31
Organism:Streptococcus agalactiae (Firmicutes)
Description:A0A0E1EGE5
Residue:599
Sequence:
MLYPLLTKTRNTYDLGGIWNFKLGEHNPNELLPSDEVMVIPTSFNDLMVSKEKRDYIGDF
WYEKVIEVPKVSEGEEMVLRFGSVTHQAKIYVDGILVGEHKGGFTPFEVLVPECKYNNEK
IKVSICANNVLDYTTLPVGNYSEIIQEDGSIKKKVRENFDFFNYAGVHRPLKLMIRPKNH
ISDITITSRLSDDLQSADLHFLVETNQKVDEVRISVFDEDNKLVGETKDSRLFLSDVHLW
EVLNAYLYTARVEIFVDNQLQDVYEENFGLREIEVTNGQFLLNRKPIYFKGFGKHEDTFI
NGRGLNEAANLMDLNLLKDIGANSFRTSHYPYSEEMMRLADRMGVLVIDEVPAVGLFQNF
NASLDLSPKDNGTWSLMQTKAAHEQAIQELVKRDKNHPSVVMWVVANEPASHEAGAHDYF
EPLVKLYKDLDPQKRPVTLVNILMATPDRDQVMDLVDVVCLNRYYGWYVDHGDLTNAEVG
LRKELLEWQDKFPDKPIIITEYGADTLPGLHSTWNIPYTEEFQCDFYEMSHRVFDGIPNL
VGEQVWNFADFETNLMILRVQGNHKGLFSRNRQPKQVVKEFKKRWMTIPHYHNKKNSVK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM163637
n/a
NameBDBM163637
Synonyms:3[(6,7Dimethyl2oxo1,2dihydroquinolin3yl)methyl]3(2hydroxyethyl)1(3 methoxyphenyl)thiourea (Inh 2) | US9334288, 4
TypeSmall organic molecule
Emp. Form.C22H25N3O3S
Mol. Mass.411.517
SMILESCOc1cccc(NC(=S)N(CCO)Cc2cc3cc(C)c(C)cc3[nH]c2=O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: