Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase receptor FLT3
LigandBDBM50430875
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
pH8±n/a
IC50 26.1±n/a nM
Commentsextracted
Citation Yang BKim YPark TWoo SLee HKim SCho JLee H Anti-inflammatory compound having inhibitory activity against multiple tyrosine kinases and pharmaceutical composition containing same US Patent  US9062066 Publication Date 6/23/2015
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase receptor FLT3
Name:Tyrosine-protein kinase receptor FLT3
Synonyms:CD_antigen: CD135 | FL cytokine receptor | FLK-2 | FLT3 | Fetal liver kinase-2 | Fms-like tyrosine kinase 3 | Fms-like tyrosine kinase 3 (Flt-3) | Fms-related tyrosine kinase 3 | Glycogen synthase kinase-3 beta (GSK3b) | Receptor-type tyrosine-protein kinase FLT3 | STK-1 | STK1 | Stem cell tyrosine kinase 1
Type:Enzyme
Mol. Mass.:112888.62
Organism:Homo sapiens (Human)
Description:P36888
Residue:993
Sequence:
MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
EDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL
QNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD
ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRE
CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM
STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE
IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHA
ENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITE
GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD
NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD
LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS
ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE
HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDL
NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDS
NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK
LIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDG
RVSECPHTYQNRRPFSREMDLGLLSPQAQVEDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50430875
n/a
NameBDBM50430875
Synonyms:CHEMBL2336005 | US9062066, LCB 03-0110
TypeSmall organic molecule
Emp. Form.C24H23N3O2S
Mol. Mass.417.523
SMILESOc1cccc(Nc2ccnc3cc(sc23)-c2cccc(CN3CCOCC3)c2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: