Reaction Details |
| Report a problem with these data |
Target | Complement factor D [24-253] |
---|
Ligand | BDBM171272 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Complement FD Thioesterolysis Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 17± 8 nM |
---|
Comments | extracted |
---|
Citation | Maibaum, J; Liao, SM; Vulpetti, A; Ostermann, N; Randl, S; Rüdisser, S; Lorthiois, E; Erbel, P; Kinzel, B; Kolb, FA; Barbieri, S; Wagner, J; Durand, C; Fettis, K; Dussauge, S; Hughes, N; Delgado, O; Hommel, U; Gould, T; Mac Sweeney, A; Gerhartz, B; Cumin, F; Flohr, S; Schubart, A; Jaffee, B; Harrison, R; Risitano, AM; Eder, J; Anderson, K Small-molecule factor D inhibitors targeting the alternative complement pathway. Nat Chem Biol12:1105-1110 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Complement factor D [24-253] |
---|
Name: | Complement factor D [24-253] |
Synonyms: | CFAD_HUMAN | CFD | Complement factor D (FD) catalytic domain (Human fD) | DF | PFD |
Type: | Protein |
Mol. Mass.: | 24622.79 |
Organism: | Homo sapiens (Human) |
Description: | P00746 (24-253 aa) |
Residue: | 230 |
Sequence: | GRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAH
SLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVA
PGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDS
CKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLA
|
|
|
BDBM171272 |
---|
n/a |
---|
Name | BDBM171272 |
Synonyms: | 1-(2-((1R,3S,5R)-3-(((R)-1-(3-Chloro-2-fluorophenyl)ethyl)carbamoyl)-2-azabicyclo[3.1.0]hexan-2-yl)-2-oxoethyl)-1H-pyrazolo[3,4-c]pyridine-3-carboxamide (6) | US9085555, 702 |
Type | Small organic molecule |
Emp. Form. | C23H22ClFN6O3 |
Mol. Mass. | 484.911 |
SMILES | C[C@@H](NC(=O)[C@@H]1C[C@H]2C[C@H]2N1C(=O)Cn1nc(C(N)=O)c2ccncc12)c1cccc(Cl)c1F |r| |
Structure |
|