| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ephrin type-A receptor 2 [596-900] |
|---|
| Ligand | BDBM50399540 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Kinobeads Competition Assay |
|---|
| Kd | 52±0.0 nM |
|---|
| Citation |  Heinzlmeir, S; Kudlinzki, D; Sreeramulu, S; Klaeger, S; Gande, SL; Linhard, V; Wilhelm, M; Qiao, H; Helm, D; Ruprecht, B; Saxena, K; Médard, G; Schwalbe, H; Kuster, B Chemical Proteomics and Structural Biology Define EPHA2 Inhibition by Clinical Kinase Drugs. ACS Chem Biol11:3400-3411 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Ephrin type-A receptor 2 [596-900] |
|---|
| Name: | Ephrin type-A receptor 2 [596-900] |
|---|
| Synonyms: | ECK | EPHA2 | EPHA2_HUMAN | Ephrin type-A receptor 2 (EPHA2) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 34367.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | EPHA2 truncation (596-900 aa); 519U |
|---|
| Residue: | 305 |
|---|
| Sequence: | DPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEK
QRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQ
LVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTS
GGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFR
LPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRL
PSTSG
|
|
|
|---|
| BDBM50399540 |
|---|
| n/a |
|---|
| Name | BDBM50399540 |
|---|
| Synonyms: | FORETINIB | US10464902, Foretinib | US10882853, Compound For-Oxide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C34H34F2N4O6 |
|---|
| Mol. Mass. | 632.6538 |
|---|
| SMILES | COc1cc2c(Oc3ccc(NC(=O)C4(CC4)C(=O)Nc4ccc(F)cc4)cc3F)ccnc2cc1OCCCN1CCOCC1 |
|---|
| Structure | 
|
|---|
Search and Browse
