| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Urokinase plasminogen activator surface receptor |
|---|
| Ligand | BDBM222355 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Fluorescence Polarization Assay |
|---|
| Ki | 2500±500 nM |
|---|
| IC50 | 26400±1600 nM |
|---|
| Citation |  Liu, D; Xu, D; Liu, M; Knabe, WE; Yuan, C; Zhou, D; Huang, M; Meroueh, SO Small Molecules Engage Hot Spots through Cooperative Binding To Inhibit a Tight Protein-Protein Interaction. Biochemistry56:1768-1784 (2017) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Urokinase plasminogen activator surface receptor |
|---|
| Name: | Urokinase plasminogen activator surface receptor |
|---|
| Synonyms: | CD_antigen=CD87 | MO3 | Monocyte activation antigen Mo3 | PLAUR | U-PAR | UPAR | UPAR_HUMAN | Urokinase plasminogen activator surface receptor | Urokinase receptor (uPAR) | Urokinase-type plasminogen activator/surface receptor |
|---|
| Type: | Receptor |
|---|
| Mol. Mass.: | 36979.14 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q03405 |
|---|
| Residue: | 335 |
|---|
| Sequence: | MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
MNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
|
|
|
|---|
| BDBM222355 |
|---|
| n/a |
|---|
| Name | BDBM222355 |
|---|
| Synonyms: | IPR-1187 (8) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H21BrClNO3 |
|---|
| Mol. Mass. | 510.807 |
|---|
| SMILES | CCc1cccc(c1)C1N(C(=O)C(O)=C1C(=O)c1ccc(Cl)cc1)c1ccc(C)c(Br)c1 |c:14| |
|---|
| Structure | 
|
|---|
Search and Browse
