| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-X-C chemokine receptor type 1 |
|---|
| Ligand | BDBM291181 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | In Vitro Affinity Assay |
|---|
| IC50 | 20.0±n/a nM |
|---|
| Citation |  Musicki, B; Aubert, J; Boiteau, J; Clary, L; Rossio, P; Schuppli-Nollet, M Disubstituted 3,4-diamino-3-cyclobutene-1,2-dione compounds for use in the treatment of chemokine-mediated diseases US Patent US9580412 Publication Date 2/28/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-X-C chemokine receptor type 1 |
|---|
| Name: | C-X-C chemokine receptor type 1 |
|---|
| Synonyms: | C-X-C chemokine receptor type 1 (CXCR-1) | C-X-C chemokine receptor type 1 (CXCR1) | CMKAR1 | CXCR1 | CXCR1_HUMAN | IL8RA | Interleukin-8 receptor A | Interleukin-8 receptors, CXCR1/CXCR2 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39803.83 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P25024 |
|---|
| Residue: | 350 |
|---|
| Sequence: | MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNKYVVIIAYALVFLLSLLGNSLV
MLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCKVVSLLKEVN
FYSGILLLACISVDRYLAIVHATRTLTQKRHLVKFVCLGCWGLSMNLSLPFFLFRQAYHP
NNSSPVCYEVLGNDTAKWRMVLRILPHTFGFIVPLFVMLFCYGFTLRTLFKAHMGQKHRA
MRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQESCERRNNIGRALDATEILGFLHSCL
NPIIYAFIGQNFRHGFLKILAMHGLVSKEFLARHRVTSYTSSSVNVSSNL
|
|
|
|---|
| BDBM291181 |
|---|
| n/a |
|---|
| Name | BDBM291181 |
|---|
| Synonyms: | 6-chloro-2-hydroxy-N,N-dimethyl-3-(2-{[(5-methylfuran-2-yl)-(tetrahydrothiophen-2-yl)methyl]amino}-3,4-dioxocyclobut-1-enylamino)benzenesulfonamide | US9580412, Example 10 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H27N3O5S2 |
|---|
| Mol. Mass. | 489.608 |
|---|
| SMILES | CN(C)S(=O)(=O)c1cccc(Nc2c(NC(C3CCCS3)c3ccc(C)o3)c(=O)c2=O)c1C |
|---|
| Structure | 
|
|---|
Search and Browse
