Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibroblast growth factor receptor 2
LigandBDBM6866
Substrate/Competitor(Biotin)Poly(Glu:Tyr)
Meas. Tech.Kinase Inhibition Assay
IC50 220±n/a nM
Citation Lin RConnolly PJHuang SWetter SKLu YMurray WVEmanuel SLGruninger RHFuentes-Pesquera ARRugg CAMiddleton SAJolliffe LK 1-Acyl-1H-[1,2,4]triazole-3,5-diamine analogues as novel and potent anticancer cyclin-dependent kinase inhibitors: synthesis and evaluation of biological activities. J Med Chem 48:4208-11 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Fibroblast growth factor receptor 2
Name:VEGF-receptor 2 and Fibroblast growth factor receptor 2
Synonyms:BEK | CD_antigen=CD332 | FGFR-2 | FGFR-2 Tyrosine Kinase | FGFR2 | Fibroblast growth factor receptor 2 (FGFR2) | Fibroblast growth factor receptor 2 precursor | KGFR | KSAM | Keratinocyte growth factor receptor | Keratinocyte growth factor receptor 2
Type:Enzyme
Mol. Mass.:92015.45
Organism:Homo sapiens (Human)
Description:P21802
Residue:821
Sequence:
MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEV
RCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYF
MVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP
AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSI
NHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSK
YGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVL
PAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTK
RIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDK
LTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKM
IGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTF
KDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKT
TNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGH
RMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYS
PSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM6866
(Biotin)Poly(Glu:Tyr)
Name:(Biotin)Poly(Glu:Tyr)
Synonyms:(Biotin)Poly(E:Y) | (Biotin)Poly(GT)
Type:Random Polymer
Mol. Mass.:358.43
Organism:n/a
Description:(Biotin)Poly(Glu:Tyr) 4:1
Residue:3
Sequence:
n/a