Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein kinase I delta
LigandBDBM6866
Substrate/CompetitorCK1 Peptide Substrate
Meas. Tech.Kinase Inhibition Assay
IC50 11200±n/a nM
Citation Lin RConnolly PJHuang SWetter SKLu YMurray WVEmanuel SLGruninger RHFuentes-Pesquera ARRugg CAMiddleton SAJolliffe LK 1-Acyl-1H-[1,2,4]triazole-3,5-diamine analogues as novel and potent anticancer cyclin-dependent kinase inhibitors: synthesis and evaluation of biological activities. J Med Chem 48:4208-11 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Casein kinase I delta
Name:Casein kinase I delta
Synonyms:CK1, delta | Casein kinase 1 Delta | Casein kinase I isoform delta | casein kinase 1, delta
Type:Enzyme
Mol. Mass.:47342.73
Organism:Rattus norvegicus (rat)
Description:Q06486
Residue:415
Sequence:
MELRVGNRYRLGRKIGSGSFGDIYLGTDIAAGEEVAIKLECVKTKHPQLHIESKIYKMMQ
GGVGIPTIRWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIH
SKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYA
SINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKRQKYERISEKKMSTPIEVL
CKGYPSEFATYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGASRA
ADDAERERRDREERLRHSRNPATRGLPSTASGRLRGTQEVAPPTPLTPTSHTANTSPRPV
SGMERERKVSMRLHRGAPVNVSSSDLTGRQDTSRMSTSQIPGRVASSGLQSVVHR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM6866
CK1 Peptide Substrate
Name:CK1 Peptide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:3083.59
Organism:n/a
Description:n/a
Residue:28
Sequence:
(Biotin)KRRRALS(phospho)VASLPGL-Amide