Reaction Details |
| Report a problem with these data |
Target | Mitogen-activated protein kinase 1 |
---|
Ligand | BDBM6878 |
---|
Substrate/Competitor | ERK-2 Peptide Substrate |
---|
Meas. Tech. | Kinase Inhibition Assay |
---|
IC50 | 1000±n/a nM |
---|
Citation | Lin, R; Connolly, PJ; Huang, S; Wetter, SK; Lu, Y; Murray, WV; Emanuel, SL; Gruninger, RH; Fuentes-Pesquera, AR; Rugg, CA; Middleton, SA; Jolliffe, LK 1-Acyl-1H-[1,2,4]triazole-3,5-diamine analogues as novel and potent anticancer cyclin-dependent kinase inhibitors: synthesis and evaluation of biological activities. J Med Chem48:4208-11 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Mitogen-activated protein kinase 1 |
---|
Name: | Mitogen-activated protein kinase 1 |
Synonyms: | ERK-2 | ERT1 | Erk2 | Extracellular signal-regulated kinase 2 | MAP kinase 2 | MAPK 2 | MK01_RAT | Mapk | Mapk1 | Mitogen-activated protein kinase 2 | Prkm1 | p42-MAPK |
Type: | Enzyme |
Mol. Mass.: | 41278.65 |
Organism: | Rattus norvegicus (rat) |
Description: | MAP Kinase is the rat ERK-2 isoform containing a polyhistidine tag at the N-terminus produced in
E.coli. and activated by phosphorylation with MEK1 prior to purification. |
Residue: | 358 |
Sequence: | MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQ
TYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLS
NDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTG
FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG
ILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRI
EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
|
|
|
BDBM6878 |
---|
ERK-2 Peptide Substrate |
---|
Name: | ERK-2 Peptide Substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 1969.25 |
Organism: | n/a |
Description: | n/a |
Residue: | 18 |
Sequence: | |