BindingDB logo
myBDB logout

BDBM50168737 (2R,3R)-1-[4-(2-Chloro-4-fluoro-benzyloxy)-benzenesulfonyl]-3-hydroxy-3-methyl-piperidine-2-carboxylic acid hydroxyamide::CHEMBL187092

SMILES: C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1


Data: 22 IC50

Find this compound or compounds like it in BindingDB or PDB:
Similarity at least:  must be >=0.5
Exact match

Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB

Found 30 hits for monomerid = 50168737   
Trg + Lig

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 11n/an/an/an/an/an/a

Pfizer Global Research and Development

Curated by ChEMBL

Assay Description
Inhibitory concentration against MMP-9

Bioorg Med Chem Lett 15: 3385-8 (2005)

Article DOI: 10.1016/j.bmcl.2005.05.037
More data for this
Ligand-Target Pair
Matrix metalloproteinase 12

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid



Eli Lilly and Company , Lilly Corporate Center, Indianapolis, Indiana 46285, United States.

Curated by ChEMBL

Assay Description
Competitive inhibition against rat cytoplasmic thymidine kinase

J Med Chem 60: 5933-5939 (2017)

Article DOI: 10.1021/acs.jmedchem.7b00650
More data for this
Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 3n/an/an/an/an/an/a


Curated by ChEMBL

Assay Description
Inhibition of ADAMTS-4 using WAAG-3R as substrate preincubated for 15 mins measured after 1 hr

J Med Chem 55: 7061-79 (2012)

Article DOI: 10.1021/jm300449x
More data for this
Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 6.30n/an/an/an/an/an/a


Curated by ChEMBL

Assay Description
Inhibition of human ADAMTS-5 expressed in CHO cells using WAAG-3R as substrate preincubated for 15 mins measured after 1 hr by FRET assay

J Med Chem 55: 7061-79 (2012)

Article DOI: 10.1021/jm300449x
More data for this
Ligand-Target Pair

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

NCI pathway
Reactome pathway


PC cid
PC sid


n/an/a 1n/an/an/an/an/an/a

Eli Lilly and Company

Curated by ChEMBL

Assay Description
Inhibition of human MMP13 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs

J Med Chem 57: 10476-85 (2014)

Article DOI: 10.1021/jm501522n
More data for this
Ligand-Target Pair
Matrix metalloproteinase-14 (MMP14)

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1


PC cid
PC sid


n/an/a 150n/an/an/an/an/an/a

Eli Lilly and Company

Curated by ChEMBL

Assay Description
Inhibition of human MMP14 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs

J Med Chem 57: 10476-85 (2014)

Article DOI: 10.1021/jm501522n
More data for this
Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 1n/an/an/an/an/an/a

Eli Lilly and Company

Curated by ChEMBL

Assay Description
Inhibition of human ADAMTS-4 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide substrate by AlphaScreen assay

J Med Chem 57: 10476-85 (2014)

Article DOI: 10.1021/jm501522n
More data for this
Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 1n/an/an/an/an/an/a

Eli Lilly and Company

Curated by ChEMBL

Assay Description
Inhibition of human ADAMTS-5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide substrate by AlphaScreen assay

J Med Chem 57: 10476-85 (2014)

Article DOI: 10.1021/jm501522n
More data for this
Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 18n/an/an/an/an/an/a

Eli Lilly and Company

Curated by ChEMBL

Assay Description
Inhibition of human ADAMTS-5 using VQTVTWPDMELPLPRNITEGEARGSVILTVKPIFEVSPSPLKG peptide substrate by AlphaScreen assay in presence of 50% rat plasma

J Med Chem 57: 10476-85 (2014)

Article DOI: 10.1021/jm501522n
More data for this
Ligand-Target Pair

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 5n/an/an/an/an/an/a

Eli Lilly and Company

Curated by ChEMBL

Assay Description
Inhibition of human MMP2 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs

J Med Chem 57: 10476-85 (2014)

Article DOI: 10.1021/jm501522n
More data for this
Ligand-Target Pair

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 3n/an/an/an/an/an/a

Eli Lilly and Company

Curated by ChEMBL

Assay Description
Inhibition of human MMP3 using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs

J Med Chem 57: 10476-85 (2014)

Article DOI: 10.1021/jm501522n
More data for this
Ligand-Target Pair

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 7n/an/an/an/an/an/a

Eli Lilly and Company

Curated by ChEMBL

Assay Description
Inhibition of human TACE using Mca-PQG1 peptide substrate assessed as substrate cleavage after 2 to 4 hrs

J Med Chem 57: 10476-85 (2014)

Article DOI: 10.1021/jm501522n
More data for this
Ligand-Target Pair

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 4n/an/an/an/an/an/a

Pfizer Global Research and Development

Curated by ChEMBL

Assay Description
Inhibitory concentration against MMP-2

Bioorg Med Chem Lett 15: 3385-8 (2005)

Article DOI: 10.1016/j.bmcl.2005.05.037
More data for this
Ligand-Target Pair

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 5n/an/an/an/an/an/a

Pfizer Global Research and Development

Curated by ChEMBL

Assay Description
Inhibitory concentration against MMP-3

Bioorg Med Chem Lett 15: 3385-8 (2005)

Article DOI: 10.1016/j.bmcl.2005.05.037
More data for this
Ligand-Target Pair
Matrix Metalloproteinase-8 (MMP-8)

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 1n/an/an/an/an/an/a

Pfizer Global Research and Development

Curated by ChEMBL

Assay Description
Inhibitory concentration against MMP-8

Bioorg Med Chem Lett 15: 3385-8 (2005)

Article DOI: 10.1016/j.bmcl.2005.05.037
More data for this
Ligand-Target Pair
Matrix metalloproteinase-1 (MMP1)

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 310n/an/an/an/an/an/a

Pfizer Global Research and Development

Curated by ChEMBL

Assay Description
Inhibitory concentration against MMP-1

Bioorg Med Chem Lett 15: 3385-8 (2005)

Article DOI: 10.1016/j.bmcl.2005.05.037
More data for this
Ligand-Target Pair
Tumor necrosis factor

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 10n/an/an/an/an/an/a

Pfizer Global Research and Development

Curated by ChEMBL

Assay Description
Inhibitory concentration against TNF-alpha releasein LPS treated whole blood

Bioorg Med Chem Lett 15: 3385-8 (2005)

Article DOI: 10.1016/j.bmcl.2005.05.037
More data for this
Ligand-Target Pair

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 1.60n/an/an/an/an/an/a


Curated by ChEMBL

Assay Description
Inhibition of TACE using Mca-PLAQAV-Dpa-RSSSR-NH2 as substrate preincubated 15 mins measured every 30 sec for 30 mins

J Med Chem 55: 7061-79 (2012)

Article DOI: 10.1021/jm300449x
More data for this
Ligand-Target Pair
Matrix metalloproteinase-1 (MMP1)

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 310n/an/an/an/an/an/a


Curated by ChEMBL

Assay Description
Inhibition of MMP-1

J Med Chem 55: 7061-79 (2012)

Article DOI: 10.1021/jm300449x
More data for this
Ligand-Target Pair

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

NCI pathway
Reactome pathway


PC cid
PC sid


n/an/a 0.900n/an/an/an/an/an/a


Curated by ChEMBL

Assay Description
Inhibition of MMP-13 using 5-FAM-TPGPLGL[Dap- (DNP)]ARRK(5-TAMRA)-amide as substrate after 45 mins

J Med Chem 55: 7061-79 (2012)

Article DOI: 10.1021/jm300449x
More data for this
Ligand-Target Pair

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 79n/an/an/an/an/an/a


Curated by ChEMBL

Assay Description
Inhibition of ADAMTS-1 using FAM (5-carbosyfluorescein)-AE*LQGRPISIAK substrate after 2 hrs

J Med Chem 55: 7061-79 (2012)

Article DOI: 10.1021/jm300449x
More data for this
Ligand-Target Pair
Matrix metalloproteinase-1 (MMP1)

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 309n/an/an/an/an/an/a

Pomona College

Curated by ChEMBL

Assay Description
Inhibition of MMP1

Bioorg Med Chem 15: 2223-68 (2007)

Article DOI: 10.1016/j.bmc.2007.01.011
More data for this
Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 4 (ADAMTS-4)

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 1n/an/an/an/an/an/a

Eli Lilly and Company , Lilly Corporate Center, Indianapolis, Indiana 46285, United States.

Curated by ChEMBL

J Med Chem 60: 5933-5939 (2017)

Article DOI: 10.1021/acs.jmedchem.7b00650
More data for this
Ligand-Target Pair
Matrix metalloproteinase (1 and 13)

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

NCI pathway
Reactome pathway


PC cid
PC sid


n/an/a 1n/an/an/an/an/an/a

Eli Lilly and Company , Lilly Corporate Center, Indianapolis, Indiana 46285, United States.

Curated by ChEMBL

J Med Chem 60: 5933-5939 (2017)

Article DOI: 10.1021/acs.jmedchem.7b00650
More data for this
Ligand-Target Pair
Matrix metalloproteinase 14

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1


PC cid
PC sid


n/an/a 150n/an/an/an/an/an/a

Eli Lilly and Company , Lilly Corporate Center, Indianapolis, Indiana 46285, United States.

Curated by ChEMBL

Assay Description
In vitro inhibitory activity against S-adenosyl-L-methionine decarboxylase using liver from rat in presence of 1 mM putrescine

J Med Chem 60: 5933-5939 (2017)

Article DOI: 10.1021/acs.jmedchem.7b00650
More data for this
Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 1n/an/an/an/an/an/a

Eli Lilly and Company , Lilly Corporate Center, Indianapolis, Indiana 46285, United States.

Curated by ChEMBL

J Med Chem 60: 5933-5939 (2017)

Article DOI: 10.1021/acs.jmedchem.7b00650
More data for this
Ligand-Target Pair
A disintegrin and metalloproteinase with thrombospondin motifs 5 (ADAMTS-5)

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 18n/an/an/an/an/an/a

Eli Lilly and Company , Lilly Corporate Center, Indianapolis, Indiana 46285, United States.

Curated by ChEMBL

J Med Chem 60: 5933-5939 (2017)

Article DOI: 10.1021/acs.jmedchem.7b00650
More data for this
Ligand-Target Pair
Matrix metalloproteinase 2/9

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 5n/an/an/an/an/an/a

Eli Lilly and Company , Lilly Corporate Center, Indianapolis, Indiana 46285, United States.

Curated by ChEMBL

J Med Chem 60: 5933-5939 (2017)

Article DOI: 10.1021/acs.jmedchem.7b00650
More data for this
Ligand-Target Pair
Matrix metalloproteinase (2 and 3)

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1

Reactome pathway


PC cid
PC sid


n/an/a 3n/an/an/an/an/an/a

Eli Lilly and Company , Lilly Corporate Center, Indianapolis, Indiana 46285, United States.

Curated by ChEMBL

J Med Chem 60: 5933-5939 (2017)

Article DOI: 10.1021/acs.jmedchem.7b00650
More data for this
Ligand-Target Pair
Matrix metalloproteinase-14 (MMP14)

(Homo sapiens (Human))
Show SMILES C[C@@]1(O)CCCN([C@H]1C(=O)NO)S(=O)(=O)c1ccc(OCc2ccc(F)cc2Cl)cc1
Show InChI InChI=1S/C20H22ClFN2O6S/c1-20(26)9-2-10-24(18(20)19(25)23-27)31(28,29)16-7-5-15(6-8-16)30-12-13-3-4-14(22)11-17(13)21/h3-8,11,18,26-27H,2,9-10,12H2,1H3,(H,23,25)/t18-,20+/m0/s1


PC cid
PC sid


n/an/a 83n/an/an/an/an/an/a

Pfizer Global Research and Development

Curated by ChEMBL

Assay Description
Inhibitory concentration against MMP-14

Bioorg Med Chem Lett 15: 3385-8 (2005)

Article DOI: 10.1016/j.bmcl.2005.05.037
More data for this
Ligand-Target Pair