Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Serine protease 1 |
---|
Ligand | BDBM14143 |
---|
Substrate/Competitor | BDBM12679 |
---|
Meas. Tech. | Enzyme Assay and Determination of the Inhibition Constants |
---|
Ki | 4400±n/a nM |
---|
Citation | Katz, BA; Sprengeler, PA; Luong, C; Verner, E; Elrod, K; Kirtley, M; Janc, J; Spencer, JR; Breitenbucher, JG; Hui, H; McGee, D; Allen, D; Martelli, A; Mackman, RL Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets. Chem Biol8:1107-21 (2001) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Serine protease 1 |
---|
Name: | Serine protease 1 |
Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
Type: | Enzyme |
Mol. Mass.: | 25790.52 |
Organism: | Bos taurus (bovine) |
Description: | P00760 |
Residue: | 246 |
Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
BDBM14143 |
---|
BDBM12679 |
---|
Name | BDBM14143 |
Synonyms: | 2-(2-HYDROXY-BIPHENYL)-1H-BENZOIMIDAZOLE-5-CARBOXAMIDINE | 2-(2-hydroxy-3-phenylphenyl)-1H-1,3-benzodiazole-5-carboximidamide | APC-7806 | CHEMBL327715 |
Type | Small organic molecule |
Emp. Form. | C20H16N4O |
Mol. Mass. | 328.3672 |
SMILES | NC(=N)c1ccc2nc([nH]c2c1)-c1cccc(-c2ccccc2)c1O |
Structure |
|