| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM14143 |
|---|
| Substrate/Competitor | BDBM12679 |
|---|
| Meas. Tech. | Enzyme Assay and Determination of the Inhibition Constants |
|---|
| Ki | 150±n/a nM |
|---|
| Citation |  Katz, BA; Sprengeler, PA; Luong, C; Verner, E; Elrod, K; Kirtley, M; Janc, J; Spencer, JR; Breitenbucher, JG; Hui, H; McGee, D; Allen, D; Martelli, A; Mackman, RL Engineering inhibitors highly selective for the S1 sites of Ser190 trypsin-like serine protease drug targets. Chem Biol8:1107-21 (2001) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25790.52 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | P00760 |
|---|
| Residue: | 246 |
|---|
| Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
|---|
| BDBM14143 |
|---|
| BDBM12679 |
|---|
| Name | BDBM14143 |
|---|
| Synonyms: | 2-(2-HYDROXY-BIPHENYL)-1H-BENZOIMIDAZOLE-5-CARBOXAMIDINE | 2-(2-hydroxy-3-phenylphenyl)-1H-1,3-benzodiazole-5-carboximidamide | APC-7806 | CHEMBL327715 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H16N4O |
|---|
| Mol. Mass. | 328.3672 |
|---|
| SMILES | NC(=N)c1ccc2nc([nH]c2c1)-c1cccc(-c2ccccc2)c1O |
|---|
| Structure | 
|
|---|
Search and Browse
