| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Metallo-beta-lactamase type 2 |
|---|
| Ligand | BDBM367868 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Enzyme Activity |
|---|
| IC50 | 1.42±n/a nM |
|---|
| Citation |  Bennett, F; Jiang, J; Pasternak, A; Dong, S; Gu, X; Scott, JD; Tang, H; Zhao, Z; Huang, Y; Hunter, D; Yang, D; Young, K; Xiao, L; Zhang, Z; Fu, J; Bai, Y; Zheng, Z; Zhang, X Metallo-beta-lactamase inhibitors US Patent US10227331 Publication Date 3/12/2019 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Metallo-beta-lactamase type 2 |
|---|
| Name: | Metallo-beta-lactamase type 2 |
|---|
| Synonyms: | B2 metallo-beta-lactamase | BLA-IMP | BLAB_SERMA | Beta-lactamase type II | IMP-1 | Metallo-beta-lactamase type II |
|---|
| Type: | undefined |
|---|
| Mol. Mass.: | 27125.88 |
|---|
| Organism: | Serratia marcescens |
|---|
| Description: | P52699 |
|---|
| Residue: | 246 |
|---|
| Sequence: | MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNA
EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELT
NELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP
YGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK
PSKPSN
|
|
|
|---|
| BDBM367868 |
|---|
| n/a |
|---|
| Name | BDBM367868 |
|---|
| Synonyms: | 3-(2-amino-1H- benzo[d]imidazol-4-yl)-6-(1- (methylsulfonyl)azetidin-3- ylsulfonyl)-2-(2H-tetrazol-5- yl)benzenesulfonamide | US10227331, Example 55 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H19N9O6S3 |
|---|
| Mol. Mass. | 553.595 |
|---|
| SMILES | CS(=O)(=O)N1CC(C1)S(=O)(=O)c1ccc(-c2cccc3[nH]c(N)nc23)c(-c2nn[nH]n2)c1S(N)(=O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
