Reaction Details |
| Report a problem with these data |
Target | Peroxisome proliferator-activated receptor alpha |
---|
Ligand | BDBM28803 |
---|
Substrate/Competitor | BDBM10852 |
---|
Meas. Tech. | Cell-Based Transcription Assay |
---|
EC50 | 17700±5400 nM |
---|
Comments | 87 +/- 14 efficacy. |
---|
Citation | Mukherjee, R; Locke, KT; Miao, B; Meyers, D; Monshizadegan, H; Zhang, R; Search, D; Grimm, D; Flynn, M; O'Malley, KM; Zhang, L; Li, J; Shi, Y; Kennedy, LJ; Blanar, M; Cheng, PT; Tino, J; Srivastava, RA Novel peroxisome proliferator-activated receptor alpha agonists lower low-density lipoprotein and triglycerides, raise high-density lipoprotein, and synergistically increase cholesterol excretion with a liver X receptor agonist. J Pharmacol Exp Ther327:716-26 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Peroxisome proliferator-activated receptor alpha |
---|
Name: | Peroxisome proliferator-activated receptor alpha |
Synonyms: | Nr1c1 | Nuclear receptor subfamily 1 group C member 1 | PPAR-alpha | PPARA_RAT | Peroxisome Proliferator-Activated Receptor alpha | Ppar | Ppara |
Type: | PROTEIN |
Mol. Mass.: | 52374.28 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_834194 |
Residue: | 468 |
Sequence: | MVDTESPICPLSPLEADDLESPLSEEFLQEMGNIQEISQSLGEESSGSFSFADYQYLGSC
PGSEGSVITDTLSPASSPSSVSCPAVPTSTDESPGNALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLAYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDLKDSETADLKSLAKRIHEAYLKNFNMNKVKARVILAGKTSNNPPFV
IHDMETLCMAEKTLVAKMVANGVENKEAEVRFFHCCQCMSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFTMLSSLMNKDGMLIAYGNGFITREFLKNLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNIGYIEKLQEGIVHVLKLHLQSNHPDDT
FLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
|
|
|
BDBM28803 |
---|
BDBM10852 |
---|
Name | BDBM28803 |
Synonyms: | 2-[4-(4-chlorophenoxy)phenoxy]propanoic acid | Clofop | Fenofibric acid | HCG 004 |
Type | Small organic molecule |
Emp. Form. | C15H13ClO4 |
Mol. Mass. | 292.714 |
SMILES | CC(Oc1ccc(Oc2ccc(Cl)cc2)cc1)C(O)=O |
Structure |
|