Reaction Details |
| Report a problem with these data |
Target | Reverse transcriptase |
---|
Ligand | BDBM50476387 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_437168 (CHEMBL906565) |
---|
IC50 | 5400±n/a nM |
---|
Citation | Mackman, RL; Zhang, L; Prasad, V; Boojamra, CG; Douglas, J; Grant, D; Hui, H; Kim, CU; Laflamme, G; Parrish, J; Stoycheva, AD; Swaminathan, S; Wang, K; Cihlar, T Synthesis, anti-HIV activity, and resistance profile of thymidine phosphonomethoxy nucleosides and their bis-isopropyloxymethylcarbonyl (bisPOC) prodrugs. Bioorg Med Chem15:5519-28 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase |
---|
Name: | Reverse transcriptase |
Synonyms: | n/a |
Type: | Protein |
Mol. Mass.: | 29598.37 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WKE8 |
Residue: | 254 |
Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
BDBM50476387 |
---|
n/a |
---|
Name | BDBM50476387 |
Synonyms: | CHEMBL229111 |
Type | Small organic molecule |
Emp. Form. | C10H15N2O7P |
Mol. Mass. | 306.2091 |
SMILES | Cc1cn([C@H]2CC[C@@H](OCP(O)(O)=O)O2)c(=O)[nH]c1=O |
Structure |
|