Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Integrase |
---|
Ligand | BDBM50123449 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_504755 (CHEMBL990229) |
---|
IC50 | 3000±n/a nM |
---|
Citation | Singh, SB; Jayasuriya, H; Salituro, GM; Zink, DL; Shafiee, A; Heimbuch, B; Silverman, KC; Lingham, RB; Genilloud, O; Teran, A; Vilella, D; Felock, P; Hazuda, D The complestatins as HIV-1 integrase inhibitors. Efficient isolation, structure elucidation, and inhibitory activities of isocomplestatin, chloropeptin I, new complestatins, A and B, and acid-hydrolysis products of chloropeptin I. J Nat Prod64:874-82 (2001) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Integrase |
---|
Name: | Integrase |
Synonyms: | pol |
Type: | PROTEIN |
Mol. Mass.: | 32203.43 |
Organism: | Human immunodeficiency virus 1 |
Description: | ChEMBL_106649 |
Residue: | 288 |
Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
BDBM50123449 |
---|
n/a |
---|
Name | BDBM50123449 |
Synonyms: | CHEMBL437996 | Chloropeptin II | ISOCOMPLESTATIN |
Type | Small organic molecule |
Emp. Form. | C61H45Cl6N7O15 |
Mol. Mass. | 1328.766 |
SMILES | [H][C@@]12NC(=O)[C@H](NC(=O)[C@@H](Cc3c[nH]c4cc(ccc34)-c3cc1cc(Oc1ccc(C[C@H](N(C)C(=O)[C@H](NC2=O)c2cc(Cl)c(O)c(Cl)c2)C(=O)N[C@@H](C(O)=O)c2ccc(O)cc2)cc1)c3O)NC(=O)C(=O)c1cc(Cl)c(O)c(Cl)c1)c1cc(Cl)c(O)c(Cl)c1 |r| |
Structure |
|