| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase protein |
|---|
| Ligand | BDBM2483 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_516597 (CHEMBL988684) |
|---|
| Ki | 1600±n/a nM |
|---|
| Citation |  Radi, M; Maga, G; Alongi, M; Angeli, L; Samuele, A; Zanoli, S; Bellucci, L; Tafi, A; Casaluce, G; Giorgi, G; Armand-Ugon, M; Gonzalez, E; Esté, JA; Baltzinger, M; Bec, G; Dumas, P; Ennifar, E; Botta, M Discovery of chiral cyclopropyl dihydro-alkylthio-benzyl-oxopyrimidine (S-DABO) derivatives as potent HIV-1 reverse transcriptase inhibitors with high activity against clinically relevant mutants. J Med Chem52:840-51 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase protein |
|---|
| Name: | Reverse transcriptase protein |
|---|
| Synonyms: | Reverse Transcriptase | Reverse Transcriptase (A62V) | Reverse Transcriptase (F61A) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 30203.56 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WJQ2 |
|---|
| Residue: | 259 |
|---|
| Sequence: | PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYEHHPDKWT
VQPIVLPEKDSWTVNDIQK
|
|
|
|---|
| BDBM2483 |
|---|
| n/a |
|---|
| Name | BDBM2483 |
|---|
| Synonyms: | (4S)-6-chloro-4-(2-cyclopropylethynyl)-4-(trifluoromethyl)-2,4-dihydro-1H-3,1-benzoxazin-2-one | CHEMBL223228 | DMP-266 | EFV | Efavirenz | Efavirenz (EFV) | L-743,726 | Sustiva |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H9ClF3NO2 |
|---|
| Mol. Mass. | 315.675 |
|---|
| SMILES | FC(F)(F)[C@]1(OC(=O)Nc2ccc(Cl)cc12)C#CC1CC1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
