Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Integrase |
---|
Ligand | BDBM50485899 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_878295 (CHEMBL2185500) |
---|
IC50 | >100000±n/a nM |
---|
Citation | Zeng, LF; Wang, Y; Kazemi, R; Xu, S; Xu, ZL; Sanchez, TW; Yang, LM; Debnath, B; Odde, S; Xie, H; Zheng, YT; Ding, J; Neamati, N; Long, YQ Repositioning HIV-1 integrase inhibitors for cancer therapeutics: 1,6-naphthyridine-7-carboxamide as a promising scaffold with drug-like properties. J Med Chem55:9492-509 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Integrase |
---|
Name: | Integrase |
Synonyms: | pol |
Type: | PROTEIN |
Mol. Mass.: | 32203.43 |
Organism: | Human immunodeficiency virus 1 |
Description: | ChEMBL_106649 |
Residue: | 288 |
Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
BDBM50485899 |
---|
n/a |
---|
Name | BDBM50485899 |
Synonyms: | CHEMBL2180572 |
Type | Small organic molecule |
Emp. Form. | C18H17BrFN5O |
Mol. Mass. | 418.263 |
SMILES | NCCNc1c(nc(Br)c2cccnc12)C(=O)NCc1ccc(F)cc1 |
Structure |
|