| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Integrase |
|---|
| Ligand | BDBM50485907 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_878296 (CHEMBL2185924) |
|---|
| IC50 | 14000±n/a nM |
|---|
| Citation |  Zeng, LF; Wang, Y; Kazemi, R; Xu, S; Xu, ZL; Sanchez, TW; Yang, LM; Debnath, B; Odde, S; Xie, H; Zheng, YT; Ding, J; Neamati, N; Long, YQ Repositioning HIV-1 integrase inhibitors for cancer therapeutics: 1,6-naphthyridine-7-carboxamide as a promising scaffold with drug-like properties. J Med Chem55:9492-509 (2012) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Integrase |
|---|
| Name: | Integrase |
|---|
| Synonyms: | pol |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 32203.43 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | ChEMBL_106649 |
|---|
| Residue: | 288 |
|---|
| Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
|---|
| BDBM50485907 |
|---|
| n/a |
|---|
| Name | BDBM50485907 |
|---|
| Synonyms: | CHEMBL2180599 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H11BrFN3O2 |
|---|
| Mol. Mass. | 376.18 |
|---|
| SMILES | Oc1c(nc(Br)c2cccnc12)C(=O)NCc1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
