Reaction Details |
| Report a problem with these data |
Target | Luteinizing hormone/choriogondaotropin receptor |
---|
Ligand | BDBM50505787 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1824038 (CHEMBL4323802) |
---|
IC50 | 78±n/a nM |
---|
Citation | Wortmann, L; Lindenthal, B; Muhn, P; Walter, A; Nubbemeyer, R; Heldmann, D; Sobek, L; Morandi, F; Schrey, AK; Moosmayer, D; Günther, J; Kuhnke, J; Koppitz, M; Lücking, U; Röhn, U; Schäfer, M; Nowak-Reppel, K; Kühne, R; Weinmann, H; Langer, G Discovery of BAY-298 and BAY-899: Tetrahydro-1,6-naphthyridine-Based, Potent, and Selective Antagonists of the Luteinizing Hormone Receptor Which Reduce Sex Hormone Levels in Vivo. J Med Chem62:10321-10341 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Luteinizing hormone/choriogondaotropin receptor |
---|
Name: | Luteinizing hormone/choriogondaotropin receptor |
Synonyms: | Luteinizing hormone/choriogondaotropin receptor |
Type: | PROTEIN |
Mol. Mass.: | 11793.16 |
Organism: | Macaca fascicularis |
Description: | ChEMBL_118864 |
Residue: | 104 |
Sequence: | FIIICACYIKIYFAVQNPELMATNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKAPL
ITVTNSKVLLVLFYPINSCANPFLYAIFTKTFQRDFFLLLSKFG
|
|
|
BDBM50505787 |
---|
n/a |
---|
Name | BDBM50505787 |
Synonyms: | CHEMBL4537998 |
Type | Small organic molecule |
Emp. Form. | C27H21ClFN3O2 |
Mol. Mass. | 473.926 |
SMILES | Fc1ccc(Oc2ccc(NC(=O)N3CCc4ncccc4[C@@H]3c3ccc(Cl)cc3)cc2)cc1 |r| |
Structure |
|