| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Luteinizing hormone/choriogondaotropin receptor |
|---|
| Ligand | BDBM50505787 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1824038 (CHEMBL4323802) |
|---|
| IC50 | 78±n/a nM |
|---|
| Citation |  Wortmann, L; Lindenthal, B; Muhn, P; Walter, A; Nubbemeyer, R; Heldmann, D; Sobek, L; Morandi, F; Schrey, AK; Moosmayer, D; Günther, J; Kuhnke, J; Koppitz, M; Lücking, U; Röhn, U; Schäfer, M; Nowak-Reppel, K; Kühne, R; Weinmann, H; Langer, G Discovery of BAY-298 and BAY-899: Tetrahydro-1,6-naphthyridine-Based, Potent, and Selective Antagonists of the Luteinizing Hormone Receptor Which Reduce Sex Hormone Levels in Vivo. J Med Chem62:10321-10341 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Luteinizing hormone/choriogondaotropin receptor |
|---|
| Name: | Luteinizing hormone/choriogondaotropin receptor |
|---|
| Synonyms: | Luteinizing hormone/choriogondaotropin receptor |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 11793.16 |
|---|
| Organism: | Macaca fascicularis |
|---|
| Description: | ChEMBL_118864 |
|---|
| Residue: | 104 |
|---|
| Sequence: | FIIICACYIKIYFAVQNPELMATNKDTKIAKKMAILIFTDFTCMAPISFFAISAAFKAPL
ITVTNSKVLLVLFYPINSCANPFLYAIFTKTFQRDFFLLLSKFG
|
|
|
|---|
| BDBM50505787 |
|---|
| n/a |
|---|
| Name | BDBM50505787 |
|---|
| Synonyms: | CHEMBL4537998 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H21ClFN3O2 |
|---|
| Mol. Mass. | 473.926 |
|---|
| SMILES | Fc1ccc(Oc2ccc(NC(=O)N3CCc4ncccc4[C@@H]3c3ccc(Cl)cc3)cc2)cc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
