Reaction Details |
| Report a problem with these data |
Target | Reverse transcriptase |
---|
Ligand | BDBM50517408 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1869038 (CHEMBL4370104) |
---|
IC50 | 129±n/a nM |
---|
Citation | Kang, D; Zhang, H; Wang, Z; Zhao, T; Ginex, T; Luque, FJ; Yang, Y; Wu, G; Feng, D; Wei, F; Zhang, J; De Clercq, E; Pannecouque, C; Chen, CH; Lee, KH; Murugan, NA; Steitz, TA; Zhan, P; Liu, X Identification of Dihydrofuro[3,4- d]pyrimidine Derivatives as Novel HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitors with Promising Antiviral Activities and Desirable Physicochemical Properties. J Med Chem62:1484-1501 (2019) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase |
---|
Name: | Reverse transcriptase |
Synonyms: | n/a |
Type: | Protein |
Mol. Mass.: | 29598.37 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WKE8 |
Residue: | 254 |
Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
BDBM50517408 |
---|
n/a |
---|
Name | BDBM50517408 |
Synonyms: | CHEMBL4546225 |
Type | Small organic molecule |
Emp. Form. | C27H28N6O3S |
Mol. Mass. | 516.615 |
SMILES | Cc1cc(cc(C)c1Oc1nc(NC2CCN(Cc3ccc(cc3)[N+]([O-])=O)CC2)nc2CSCc12)C#N |
Structure |
|