| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase |
|---|
| Ligand | BDBM50517409 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1869038 (CHEMBL4370104) |
|---|
| IC50 | 77±n/a nM |
|---|
| Citation |  Kang, D; Zhang, H; Wang, Z; Zhao, T; Ginex, T; Luque, FJ; Yang, Y; Wu, G; Feng, D; Wei, F; Zhang, J; De Clercq, E; Pannecouque, C; Chen, CH; Lee, KH; Murugan, NA; Steitz, TA; Zhan, P; Liu, X Identification of Dihydrofuro[3,4- d]pyrimidine Derivatives as Novel HIV-1 Non-Nucleoside Reverse Transcriptase Inhibitors with Promising Antiviral Activities and Desirable Physicochemical Properties. J Med Chem62:1484-1501 (2019) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase |
|---|
| Name: | Reverse transcriptase |
|---|
| Synonyms: | n/a |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29598.37 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WKE8 |
|---|
| Residue: | 254 |
|---|
| Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
|---|
| BDBM50517409 |
|---|
| n/a |
|---|
| Name | BDBM50517409 |
|---|
| Synonyms: | CHEMBL4557661 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C28H31N5O4S |
|---|
| Mol. Mass. | 533.642 |
|---|
| SMILES | Cc1cc(cc(C)c1Oc1nc(NC2CCN(Cc3ccc(cc3)S(C)(=O)=O)CC2)nc2COCc12)C#N |
|---|
| Structure | 
|
|---|
Search and Browse
