Reaction Details |
| Report a problem with these data |
Target | Folate receptor alpha |
---|
Ligand | BDBM50534430 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1928966 (CHEMBL4432142) |
---|
IC50 | 3.0±n/a nM |
---|
Citation | Golani, LK; Wallace-Povirk, A; Deis, SM; Wong, J; Ke, J; Gu, X; Raghavan, S; Wilson, MR; Li, X; Polin, L; de Waal, PW; White, K; Kushner, J; O'Connor, C; Hou, Z; Xu, HE; Melcher, K; Dann, CE; Matherly, LH; Gangjee, A Tumor Targeting with Novel 6-Substituted Pyrrolo [2,3-d] Pyrimidine Antifolates with Heteroatom Bridge Substitutions via Cellular Uptake by Folate Receptor ? and the Proton-Coupled Folate Transporter and Inhibition of de Novo Purine Nucleotide Biosynthesis. J Med Chem59:7856-76 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Folate receptor alpha |
---|
Name: | Folate receptor alpha |
Synonyms: | Adult folate-binding protein | FBP | FOLR | FOLR1 | FOLR1_HUMAN | FR-alpha | Folate receptor 1 | Folate receptor, adult | KB cells FBP | Ovarian tumor-associated antigen MOv18 |
Type: | PROTEIN |
Mol. Mass.: | 29827.41 |
Organism: | Homo sapiens (Human) |
Description: | ChEMBL_1469596 |
Residue: | 257 |
Sequence: | MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPW
RKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQV
DQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHF
YFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWA
AWPFLLSLALMLLWLLS
|
|
|
BDBM50534430 |
---|
n/a |
---|
Name | BDBM50534430 |
Synonyms: | CHEMBL4471269 |
Type | Small organic molecule |
Emp. Form. | C21H22N6O7 |
Mol. Mass. | 470.4354 |
SMILES | Nc1nc2[nH]c(CCN(C=O)c3ccc(cc3)C(=O)N[C@@H](CCC(O)=O)C(O)=O)cc2c(=O)[nH]1 |r| |
Structure |
|