| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Folate receptor beta |
|---|
| Ligand | BDBM50534427 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1928967 (CHEMBL4432143) |
|---|
| IC50 | 0.620000±n/a nM |
|---|
| Citation |  Golani, LK; Wallace-Povirk, A; Deis, SM; Wong, J; Ke, J; Gu, X; Raghavan, S; Wilson, MR; Li, X; Polin, L; de Waal, PW; White, K; Kushner, J; O'Connor, C; Hou, Z; Xu, HE; Melcher, K; Dann, CE; Matherly, LH; Gangjee, A Tumor Targeting with Novel 6-Substituted Pyrrolo [2,3-d] Pyrimidine Antifolates with Heteroatom Bridge Substitutions via Cellular Uptake by Folate Receptor ? and the Proton-Coupled Folate Transporter and Inhibition of de Novo Purine Nucleotide Biosynthesis. J Med Chem59:7856-76 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Folate receptor beta |
|---|
| Name: | Folate receptor beta |
|---|
| Synonyms: | FBP | FOLR2 | FOLR2_HUMAN | FR-beta | Folate receptor 2 | Folate receptor beta | Folate receptor, fetal/placental | Placental folate-binding protein |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 29286.32 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_20077 |
|---|
| Residue: | 255 |
|---|
| Sequence: | MVWKWMPLLLLLVCVATMCSAQDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACC
TASTSQELHKDTSRLYNFNWDHCGKMEPACKRHFIQDTCLYECSPNLGPWIQQVNQSWRK
ERFLDVPLCKEDCQRWWEDCHTSHTCKSNWHRGWDWTSGVNKCPAGALCRTFESYFPTPA
ALCEGLWSHSYKVSNYSRGSGRCIQMWFDSAQGNPNEEVARFYAAAMHVNAGEMLHGTGG
LLLSLALMLQLWLLG
|
|
|
|---|
| BDBM50534427 |
|---|
| n/a |
|---|
| Name | BDBM50534427 |
|---|
| Synonyms: | CHEMBL4437824 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H22N6O6 |
|---|
| Mol. Mass. | 442.4253 |
|---|
| SMILES | Nc1nc2[nH]c(CCNc3ccc(cc3)C(=O)N[C@@H](CCC(O)=O)C(O)=O)cc2c(=O)[nH]1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
