| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-C chemokine receptor type 1 |
|---|
| Ligand | BDBM50096540 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_49835 |
|---|
| IC50 | 10000±n/a nM |
|---|
| Citation |  Finke, PE; Meurer, LC; Oates, B; Mills, SG; MacCoss, M; Malkowitz, L; Springer, MS; Daugherty, BL; Gould, SL; DeMartino, JA; Siciliano, SJ; Carella, A; Carver, G; Holmes, K; Danzeisen, R; Hazuda, D; Kessler, J; Lineberger, J; Miller, M; Schleif, WA; Emini, EA Antagonists of the human CCR5 receptor as anti-HIV-1 agents. Part 2: structure-activity relationships for substituted 2-Aryl-1-[N-(methyl)-N-(phenylsulfonyl)amino]-4-(piperidin-1-yl)butanes. Bioorg Med Chem Lett11:265-70 (2001) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-C chemokine receptor type 1 |
|---|
| Name: | C-C chemokine receptor type 1 |
|---|
| Synonyms: | C-C CKR-1 | C-C chemokine receptor type 1 (CCR1) | CC-CKR-1 | CCR-1 | CCR1 | CCR1_HUMAN | CD_antigen=CD191 | CMKBR1 | CMKR1 | HM145 | LD78 receptor | MIP-1alpha-R | Macrophage inflammatory protein 1-alpha receptor | RANTES-R | SCYAR1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 41180.69 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P32246 |
|---|
| Residue: | 355 |
|---|
| Sequence: | METPNTTEDYDTTTEFDYGDATPCQKVNERAFGAQLLPPLYSLVFVIGLVGNILVVLVLV
QYKRLKNMTSIYLLNLAISDLLFLFTLPFWIDYKLKDDWVFGDAMCKILSGFYYTGLYSE
IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIIIWALAILASMPGLYFSKTQWEFTH
HTCSLHFPHESLREWKLFQALKLNLFGLVLPLLVMIICYTGIIKILLRRPNEKKSKAVRL
IFVIMIIFFLFWTPYNLTILISVFQDFLFTHECEQSRHLDLAVQVTEVIAYTHCCVNPVI
YAFVGERFRKYLRQLFHRRVAVHLVKWLPFLSVDRLERVSSTSPSTGEHELSAGF
|
|
|
|---|
| BDBM50096540 |
|---|
| n/a |
|---|
| Name | BDBM50096540 |
|---|
| Synonyms: | (2S)-2-(3-chlorophenyl)-1-[(N-methyl-N-phenylsulfonyl)amino]-4-[spiro(2,3-dihydrobenzthiophene-3,40-piperidin-10-yl)]butane S-oxide | 1'-[3-(3-chlorophenyl)-4-methyl(phenyl)sulfonamido-(3S)-butyl]spiro[2,3-dihydrobenzo[b]thiophene-1-oxide-3,4'-(hexahydropyridine)] | 1-oxo-1'-[3-(3-chlorophenyl)-4-methyl(phenyl)sulfonamido-(3S)-butyl]spiro[2,3-dihydrobenzo[b]thiophene-3,4'-(hexahydropyridine)] | Analogue of 1-[N-(Methyl)-N-(phenylsulfonyl)amino]-2-(phenyl)-4-[4-(substituted)piperidin-1-yl]butane | CHEMBL83338 | N-{(S)-2-(3-chloro-phenyl)-4-[4-(1-oxo-spiro-(1-benzothiophene-3,4-piperidin-1-yl)]-butyl}-N-methyl-benzenesulfonamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H33ClN2O3S2 |
|---|
| Mol. Mass. | 557.167 |
|---|
| SMILES | CN(C[C@@H](CCN1CCC2(CS(=O)c3ccccc23)CC1)c1cccc(Cl)c1)S(=O)(=O)c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
