| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proteasome subunit beta type-5 |
|---|
| Ligand | BDBM50554394 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2049562 (CHEMBL4704261) |
|---|
| IC50 | 424±n/a nM |
|---|
| Citation |  Zhan, W; Singh, PK; Ban, Y; Qing, X; Ah Kioon, MD; Fan, H; Zhao, Q; Wang, R; Sukenick, G; Salmon, J; Warren, JD; Ma, X; Barrat, FJ; Nathan, CF; Lin, G Structure-Activity Relationships of Noncovalent Immunoproteasome ?5i-Selective Dipeptides. J Med Chem63:13103-13123 (2020) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Proteasome subunit beta type-5 |
|---|
| Name: | Proteasome subunit beta type-5 |
|---|
| Synonyms: | 20S proteasome chymotrypsin-like | 26S proteosome | LMPX | MB1 | PSB5_HUMAN | PSMB5 | Proteasome Macropain subunit MB1 | Proteasome subunit beta type-1/beta type-5 | X |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 28480.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 263 |
|---|
| Sequence: | MALASVLERPLPVNQRGFFGLGGRADLLDLGPGSLSDGLSLAAPGWGVPEEPGIEMLHGT
TTLAFKFRHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGATFSVGSGSVYAYGVMDRGYSYDLEVEQAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHEKYSGSTP
|
|
|
|---|
| BDBM50554394 |
|---|
| n/a |
|---|
| Name | BDBM50554394 |
|---|
| Synonyms: | CHEMBL4784875 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C30H38N4O5S |
|---|
| Mol. Mass. | 566.712 |
|---|
| SMILES | C[C@H](NC(=O)[C@H](CCC(=O)NC(C)(C)C)NS(=O)(=O)c1ccc(C)cc1)C(=O)NCc1cccc2ccccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
