Reaction Details |
| Report a problem with these data |
Target | Galectin-3 |
---|
Ligand | BDBM541746 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2213340 (CHEMBL5126289) |
---|
IC50 | 48±n/a nM |
---|
Citation | Liu, C; Jalagam, PR; Feng, J; Wang, W; Raja, T; Sura, MR; Manepalli, RKVLP; Aliphedi, BR; Medavarapu, S; Nair, SK; Muthalagu, V; Natesan, R; Gupta, A; Beno, B; Panda, M; Ghosh, K; Shukla, JK; Sale, H; Haldar, P; Kalidindi, N; Shah, D; Patel, D; Mathur, A; Ellsworth, BA; Cheng, D; Regueiro-Ren, A Identification of Monosaccharide Derivatives as Potent, Selective, and Orally Bioavailable Inhibitors of Human and Mouse Galectin-3. J Med Chem65:11084-11099 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Galectin-3 |
---|
Name: | Galectin-3 |
Synonyms: | LEG3_MOUSE | Lgals3 |
Type: | PROTEIN |
Mol. Mass.: | 27519.08 |
Organism: | Mus musculus |
Description: | ChEMBL_302220 |
Residue: | 264 |
Sequence: | MADSFSLNDALAGSGNPNPQGYPGAWGNQPGAGGYPGAAYPGAYPGQAPPGAYPGQAPPG
AYPGQAPPSAYPGPTAPGAYPGPTAPGAYPGQPAPGAFPGQPGAPGAYPQCSGGYPAAGP
YGVPAGPLTVPYDLPLPGGVMPRMLITIMGTVKPNANRIVLDFRRGNDVAFHFNPRFNEN
NRRVIVCNTKQDNNWGKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYNHRMK
NLREISQLGISGDITLTSANHAMI
|
|
|
BDBM541746 |
---|
n/a |
---|
Name | BDBM541746 |
Synonyms: | US11267811, Example A78 |
Type | Small organic molecule |
Emp. Form. | C24H19BrClF5N6O4 |
Mol. Mass. | 665.794 |
SMILES | Cc1nc([C@@H]2O[C@H](CO)[C@H](O)[C@@H]([C@H]2O)n2cc(nn2)-c2ccc(Br)c(F)c2F)n(n1)-c1cc(Cl)ccc1C(F)(F)F |r| |
Structure |
|