| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gonadotropin-releasing hormone receptor |
|---|
| Ligand | BDBM50260755 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_552282 (CHEMBL995612) |
|---|
| Ki | 3900±n/a nM |
|---|
| Citation |  Chen, C; Chen, Y; Pontillo, J; Guo, Z; Huang, CQ; Wu, D; Madan, A; Chen, T; Wen, J; Xie, Q; Tucci, FC; Rowbottom, M; Zhu, YF; Wade, W; Saunders, J; Bozigian, H; Struthers, RS Potent and orally bioavailable zwitterion GnRH antagonists with low CYP3A4 inhibitory activity. Bioorg Med Chem Lett18:3301-5 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gonadotropin-releasing hormone receptor |
|---|
| Name: | Gonadotropin-releasing hormone receptor |
|---|
| Synonyms: | GNRHR | GNRHR_HUMAN | GRHR | GnRH receptor | GnRH-R | Gonadotropin releasing hormone 1 (GnRHR1) | Gonadotropin-releasing hormone receptor | Gonadotropin-releasing hormone receptor (GnRH) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 37749.45 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P30968 |
|---|
| Residue: | 328 |
|---|
| Sequence: | MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR
VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
|
|
|
|---|
| BDBM50260755 |
|---|
| n/a |
|---|
| Name | BDBM50260755 |
|---|
| Synonyms: | (R)-2-(4-(1-(2-fluoro-6-(trifluoromethyl)benzyl)-3-(2-amino-2-phenylethyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)benzylamino)acetic acid | CHEMBL499849 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H26F4N4O4 |
|---|
| Mol. Mass. | 570.5348 |
|---|
| SMILES | N[C@@H](Cn1c(=O)c(cn(Cc2c(F)cccc2C(F)(F)F)c1=O)-c1ccc(CNCC(O)=O)cc1)c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
