| Reaction Details |
|---|
 | Report a problem with these data |
| Target | 5-hydroxytryptamine receptor 1B |
|---|
| Ligand | BDBM50243699 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_554186 (CHEMBL963643) |
|---|
| Ki | 60±n/a nM |
|---|
| Citation |  Pelletier, JC; Chengalvala, M; Cottom, J; Feingold, I; Garrick, L; Green, D; Hauze, D; Huselton, C; Jetter, J; Kao, W; Kopf, GS; Lundquist, JT; Mann, C; Mehlmann, J; Rogers, J; Shanno, L; Wrobel, J 2-phenyl-4-piperazinylbenzimidazoles: orally active inhibitors of the gonadotropin releasing hormone (GnRH) receptor. Bioorg Med Chem16:6617-40 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| 5-hydroxytryptamine receptor 1B |
|---|
| Name: | 5-hydroxytryptamine receptor 1B |
|---|
| Synonyms: | 5-HT-1B | 5-HT-1D-beta | 5-HT1B | 5-hydroxytryptamine receptor 1B (5-HT1B) | 5HT1B_HUMAN | HTR1B | HTR1DB | S12 | Serotonin (5-HT) receptor | Serotonin 1D beta receptor | Serotonin Receptor 1B |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 43579.17 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Receptor binding assays were performed using human clone stably expressed in CHO cells |
|---|
| Residue: | 390 |
|---|
| Sequence: | MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
|
|
|
|---|
| BDBM50243699 |
|---|
| n/a |
|---|
| Name | BDBM50243699 |
|---|
| Synonyms: | 2-(trifluoromethyl)-7-(2-(4-(2-(trifluoromethyl)-1H-benzo[d]imidazol-4-yl)piperazin-1-yl)ethoxy)-1H-benzo[d]imidazole | CHEMBL472117 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C22H20F6N6O |
|---|
| Mol. Mass. | 498.4242 |
|---|
| SMILES | FC(F)(F)c1nc2cccc(OCCN3CCN(CC3)c3cccc4[nH]c(nc34)C(F)(F)F)c2[nH]1 |
|---|
| Structure | 
|
|---|
Search and Browse
