Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Kallikrein-1 |
---|
Ligand | BDBM50090231 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_92391 |
---|
Ki | 92000±n/a nM |
---|
Citation | Baettig, U; Brown, L; Brundish, D; Dell, C; Furzer, A; Garman, S; Janus, D; Kane, PD; Smith, G; Walker, CV; Cockcroft, X; Ambler, J; Mitchelson, A; Talbot, MD; Tweed, M; Wills, N The design and synthesis of thrombin inhibitors: analogues of MD805 containing non-polar surrogates for arginine at the P1 position. Bioorg Med Chem Lett10:1563-6 (2000) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Kallikrein-1 |
---|
Name: | Kallikrein-1 |
Synonyms: | KLK1 | KLK1_HUMAN | Kallikrein 1 | Kallikrein-1 | Kidney/pancreas/salivary gland kallikrein | Tissue kallikrein |
Type: | Enzyme |
Mol. Mass.: | 28874.69 |
Organism: | Homo sapiens (Human) |
Description: | P06870 |
Residue: | 262 |
Sequence: | MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
|
|
|
BDBM50090231 |
---|
n/a |
---|
Name | BDBM50090231 |
Synonyms: | CHEMBL39375 | MD805 Analogue |
Type | Small organic molecule |
Emp. Form. | C28H36N4O3S2 |
Mol. Mass. | 540.74 |
SMILES | CCC1CCN(CC1)C(=O)C(Cc1nc2ccccc2s1)NS(=O)(=O)c1cccc2CC(C)(C)CNc12 |
Structure |
|