| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mu-type opioid receptor |
|---|
| Ligand | BDBM50008855 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_146264 |
|---|
| Ki | 62.0±n/a nM |
|---|
| Citation |  Halfpenny, PR; Horwell, DC; Hughes, J; Humblet, C; Hunter, JC; Neuhaus, D; Rees, DC Highly selective kappa opioid analgesics. 4. Synthesis of some conformationally restricted naphthalene derivatives with high receptor affinity and selectivity. J Med Chem34:190-4 (1991) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Mu-type opioid receptor |
|---|
| Name: | Mu-type opioid receptor |
|---|
| Synonyms: | M-OR-1 | MOR-1 | Mu opioid receptor | Mu-type opioid receptor (Mu) | OPIATE Mu | OPRM1 | OPRM_CAVPO |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 11165.58 |
|---|
| Organism: | GUINEA PIG |
|---|
| Description: | P97266 |
|---|
| Residue: | 98 |
|---|
| Sequence: | YTKMKTATNIYIFNLALADALATSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSI
FTLCTMSVDRYIAVCHPVKALDFRTPRNAKTVNVCNWI
|
|
|
|---|
| BDBM50008855 |
|---|
| n/a |
|---|
| Name | BDBM50008855 |
|---|
| Synonyms: | 4,5-Dihydro-3H-naphtho[1,8-bc]thiophene-5-carboxylic acid methyl-(7-pyrrolidin-1-yl-1-oxa-spiro[4.5]dec-8-yl)-amide; compound with toluene-4-sulfonic acid | CHEMBL300831 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H34N2O2S |
|---|
| Mol. Mass. | 438.625 |
|---|
| SMILES | CN([C@H]1CCC2(CCCO2)C[C@@H]1N1CCCC1)C(=O)C1CCc2csc3cccc1c23 |
|---|
| Structure | 
|
|---|
Search and Browse
