Reaction Details |
| Report a problem with these data |
Target | Cathepsin D |
---|
Ligand | BDBM50373810 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_468540 (CHEMBL931965) |
---|
IC50 | 7940±n/a nM |
---|
Citation | Clarke, B; Demont, E; Dingwall, C; Dunsdon, R; Faller, A; Hawkins, J; Hussain, I; MacPherson, D; Maile, G; Matico, R; Milner, P; Mosley, J; Naylor, A; O'Brien, A; Redshaw, S; Riddell, D; Rowland, P; Soleil, V; Smith, KJ; Stanway, S; Stemp, G; Sweitzer, S; Theobald, P; Vesey, D; Walter, DS; Ward, J; Wayne, G BACE-1 inhibitors part 1: identification of novel hydroxy ethylamines (HEAs). Bioorg Med Chem Lett18:1011-6 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cathepsin D |
---|
Name: | Cathepsin D |
Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
Type: | Enzyme |
Mol. Mass.: | 44551.72 |
Organism: | Homo sapiens (Human) |
Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
Residue: | 412 |
Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
BDBM50373810 |
---|
n/a |
---|
Name | BDBM50373810 |
Synonyms: | CHEMBL258068 |
Type | Small organic molecule |
Emp. Form. | C32H44N4O5 |
Mol. Mass. | 564.7156 |
SMILES | CCOc1cc(cc(c1)C(=O)N[C@@H](Cc1ccccc1)[C@H](O)CN[C@@H](C)C(=O)NC1CCCCC1)N1CCCC1=O |
Structure |
|