Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase pim-1 |
---|
Ligand | BDBM50387310 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_828048 (CHEMBL2049742) |
---|
IC50 | 10±n/a nM |
---|
Citation | Dakin, LA; Block, MH; Chen, H; Code, E; Dowling, JE; Feng, X; Ferguson, AD; Green, I; Hird, AW; Howard, T; Keeton, EK; Lamb, ML; Lyne, PD; Pollard, H; Read, J; Wu, AJ; Zhang, T; Zheng, X Discovery of novel benzylidene-1,3-thiazolidine-2,4-diones as potent and selective inhibitors of the PIM-1, PIM-2, and PIM-3 protein kinases. Bioorg Med Chem Lett22:4599-604 (2012) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Serine/threonine-protein kinase pim-1 |
---|
Name: | Serine/threonine-protein kinase pim-1 |
Synonyms: | PIM-1 Kinase | PIM1 | PIM1_HUMAN | Proto-oncogene serine/threonine-protein kinase Pim-1 | Serine/threonine-protein kinase (PIM1) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase PIM1 | Serine/threonine-protein kinase pim-1 (PIM1) |
Type: | Protein |
Mol. Mass.: | 35681.82 |
Organism: | Homo sapiens (Human) |
Description: | P11309 |
Residue: | 313 |
Sequence: | MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSD
NLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLIL
ERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRG
ELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDI
PFEHDEEIIRGQVFFRQRVSSECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETA
EIHLHSLSPGPSK
|
|
|
BDBM50387310 |
---|
n/a |
---|
Name | BDBM50387310 |
Synonyms: | CHEMBL2048867 |
Type | Small organic molecule |
Emp. Form. | C15H16BrN3O2S |
Mol. Mass. | 382.275 |
SMILES | N[C@@H]1CCCN(C1)c1c(Br)cccc1C=C1SC(O)=NC1=O |r,w:14.15,c:20| |
Structure |
|