Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Cathepsin D |
---|
Ligand | BDBM50427565 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_941702 (CHEMBL2330925) |
---|
IC50 | 11000±n/a nM |
---|
Citation | Lorthiois, E; Breitenstein, W; Cumin, F; Ehrhardt, C; Francotte, E; Jacoby, E; Ostermann, N; Sellner, H; Kosaka, T; Webb, RL; Rigel, DF; Hassiepen, U; Richert, P; Wagner, T; Maibaum, J The discovery of novel potent trans-3,4-disubstituted pyrrolidine inhibitors of the human aspartic protease renin from in silico three-dimensional (3D) pharmacophore searches. J Med Chem56:2207-17 (2013) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cathepsin D |
---|
Name: | Cathepsin D |
Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
Type: | Enzyme |
Mol. Mass.: | 44551.72 |
Organism: | Homo sapiens (Human) |
Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
Residue: | 412 |
Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
BDBM50427565 |
---|
n/a |
---|
Name | BDBM50427565 |
Synonyms: | CHEMBL2322896 |
Type | Small organic molecule |
Emp. Form. | C24H25ClN2 |
Mol. Mass. | 376.922 |
SMILES | Clc1ccc(cc1)N(C[C@@H]1CNC[C@H]1Cc1ccccc1)c1ccccc1 |r| |
Structure |
|