| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tryptase delta |
|---|
| Ligand | BDBM50217814 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_210701 (CHEMBL817298) |
|---|
| IC50 | 71.0±n/a nM |
|---|
| Citation |  Slusarchyk, WA; Bolton, SA; Hartl, KS; Huang, MH; Jacobs, G; Meng, W; Ogletree, ML; Pi, Z; Schumacher, WA; Seiler, SM; Sutton, JC; Treuner, U; Zahler, R; Zhao, G; Bisacchi, GS Synthesis of potent and highly selective inhibitors of human tryptase. Bioorg Med Chem Lett12:3235-8 (2002) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Tryptase delta |
|---|
| Name: | Tryptase delta |
|---|
| Synonyms: | Delta-tryptase | HmMCP-3-like tryptase III | Mast cell mMCP-7-like | TPSD1 | TRYD_HUMAN | Tryptase delta | Tryptase-3 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 26578.73 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_104777 |
|---|
| Residue: | 242 |
|---|
| Sequence: | MLLLAPQMLSLLLLALPVLASPAYVAPAPGQALQQTGIVGGQEAPRSKWPWQVSLRVRGP
YWMHFCGGSLIHPQWVLTAAHCVEPDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQF
YIIQTGADIALLELEEPVNISSHIHTVTLPPASETFPPGMPCWVTGWGDVDNNVHLPPPY
PLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRDDMLCAGSENHDSCQGDSGGPLVCKVN
GT
|
|
|
|---|
| BDBM50217814 |
|---|
| n/a |
|---|
| Name | BDBM50217814 |
|---|
| Synonyms: | CHEMBL324621 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H40N6O6 |
|---|
| Mol. Mass. | 508.611 |
|---|
| SMILES | CC(C)C(OC(=O)N1CCN(CC1)C(=O)N1[C@@H]([C@@H](CC2CCCN(C2)C(N)=N)C1=O)C(O)=O)C(C)C |
|---|
| Structure | 
|
|---|
Search and Browse
