Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Complement factor D |
---|
Ligand | BDBM109178 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Human Factor D Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 298.15±n/a K |
---|
IC50 | <1000±n/a nM |
---|
Comments | extracted |
---|
Citation | Wiles, JA; Wang, Q; Gadhachanda, VR; Pais, G; Hashimoto, A; Chen, D; Wang, X; Agarwal, A; Deshpande, M; Phadke, AS Amide compounds for treatment of complement mediated disorders US Patent US9695205 Publication Date 7/4/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Complement factor D |
---|
Name: | Complement factor D |
Synonyms: | Adipsin | C3 convertase activator | CFAD_HUMAN | CFD | DF | PFD | Properdin factor D |
Type: | Protein |
Mol. Mass.: | 27039.19 |
Organism: | Homo sapiens (Human) |
Description: | P00746 |
Residue: | 253 |
Sequence: | MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
|
|
|
BDBM109178 |
---|
n/a |
---|
Name | BDBM109178 |
Synonyms: | US9695205, 13 |
Type | Small organic molecule |
Emp. Form. | C29H28ClF4N5O4 |
Mol. Mass. | 622.01 |
SMILES | CC(=O)c1cn(CC(=O)N2C[C@H](F)C[C@H]2C(=O)NCc2cccc(Cl)c2F)c2ccc(NC(=O)N3CCC(F)(F)C3)cc12 |r| |
Structure |
|