Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Protein arginine N-methyltransferase 6 |
---|
Ligand | BDBM178101 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | PRMT Biochemical Assays |
---|
Ki | 110±6 nM |
---|
IC50 | 230±12 nM |
---|
Citation | Eram, MS; Shen, Y; Szewczyk, MM; Wu, H; Senisterra, G; Li, F; Butler, KV; Kaniskan, Hÿ; Speed, BA; Dela Seña, C; Dong, A; Zeng, H; Schapira, M; Brown, PJ; Arrowsmith, CH; Barsyte-Lovejoy, D; Liu, J; Vedadi, M; Jin, J A Potent, Selective, and Cell-Active Inhibitor of Human Type I Protein Arginine Methyltransferases. ACS Chem Biol11:772-81 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Protein arginine N-methyltransferase 6 |
---|
Name: | Protein arginine N-methyltransferase 6 |
Synonyms: | ANM6_HUMAN | HRMT1L6 | Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6 | Histone-arginine N-methyltransferase PRMT6 | PRMT6 | Protein arginine methyltransferase 6 (PRMT6) |
Type: | Protein |
Mol. Mass.: | 41928.48 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 375 |
Sequence: | MSQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECYSDVSVHEEM
IADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQA
REVVRFNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKE
GGLLLPASAELFIAPISDQMLEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQG
LSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGE
SEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYK
VGDQEEKTKDFAMED
|
|
|
BDBM178101 |
---|
n/a |
---|
Name | BDBM178101 |
Synonyms: | N1-Methyl-N1-((5-(3-(trifluoromethyl)phenyl)-2H-1,2,3-triazol-4-yl)methyl)ethane-1,2-diamine (Compound 1) |
Type | Small organic molecule |
Emp. Form. | C13H16F3N5 |
Mol. Mass. | 299.2948 |
SMILES | CN(CCN)Cc1n[nH]nc1-c1cccc(c1)C(F)(F)F |
Structure |
|