| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine/threonine-protein kinase WNK1 [198-401] |
|---|
| Ligand | BDBM49829 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | WNK1 HTRF Assay |
|---|
| IC50 | 8.8e+3±n/a nM |
|---|
| Citation |  Yamada, K; Zhang, JH; Xie, X; Reinhardt, J; Xie, AQ; LaSala, D; Kohls, D; Yowe, D; Burdick, D; Yoshisue, H; Wakai, H; Schmidt, I; Gunawan, J; Yasoshima, K; Yue, QK; Kato, M; Mogi, M; Idamakanti, N; Kreder, N; Drueckes, P; Pandey, P; Kawanami, T; Huang, W; Yagi, YI; Deng, Z; Park, HM Discovery and Characterization of Allosteric WNK Kinase Inhibitors. ACS Chem Biol11:3338-3346 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine/threonine-protein kinase WNK1 [198-401] |
|---|
| Name: | Serine/threonine-protein kinase WNK1 [198-401] |
|---|
| Synonyms: | HSN2 | KDP | KIAA0344 | PRKWNK1 | WNK1 | WNK1_HUMAN | With-No-Lysine kinase 1 (WNK1) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 23499.53 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | WNK1 truncation (198-401 aa) |
|---|
| Residue: | 204 |
|---|
| Sequence: | SQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLDTETTVEVAWCELQDRKL
TKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFK
VMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRA
SFAKSVIGTPEFMAPEMYEEKYDE
|
|
|
|---|
| BDBM49829 |
|---|
| n/a |
|---|
| Name | BDBM49829 |
|---|
| Synonyms: | (2-fluorophenyl)(5-(2-(methylamino)thiazol-4-yl)indolin-1-yl)methanone (Compound 1) | (2-fluorophenyl)-[5-[2-(methylamino)-1,3-thiazol-4-yl]-2,3-dihydroindol-1-yl]methanone | (2-fluorophenyl)-[5-[2-(methylamino)-4-thiazolyl]-2,3-dihydroindol-1-yl]methanone | (2-fluorophenyl)-[5-[2-(methylamino)thiazol-4-yl]indolin-1-yl]methanone | MLS000718316 | SMR000290584 | cid_1450294 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H16FN3OS |
|---|
| Mol. Mass. | 353.413 |
|---|
| SMILES | CNc1nc(cs1)-c1ccc2N(CCc2c1)C(=O)c1ccccc1F |
|---|
| Structure | 
|
|---|
Search and Browse
