| Reaction Details |
|---|
 | Report a problem with these data |
| Target | E3 ubiquitin-protein ligase SMURF1 [420-757] |
|---|
| Ligand | BDBM239122 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Biochemical Assay |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 100±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Bala, KJ; Brearley, A; Dale, J; Edwards, A; Ahmed, M; Porter, D; Pulz, RA; Rooney, LA; Sandham, DA; Shaw, D; Smith, N; Taylor, JL; Taylor, RJ; Troxler, TJ; Wrigglesworth, J Carboxamide derivatives US Patent US9403810 Publication Date 8/2/2016 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| E3 ubiquitin-protein ligase SMURF1 [420-757] |
|---|
| Name: | E3 ubiquitin-protein ligase SMURF1 [420-757] |
|---|
| Synonyms: | HECT-type E3 ubiquitin transferase SMURF1 | KIAA1625 | SMUF1_HUMAN | SMURF1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 39188.96 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | HECTdomain amino acid 420-757 |
|---|
| Residue: | 338 |
|---|
| Sequence: | RPKDLKKRLMVKFRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDS
SINPDHLSYFHFVGRIMGLAVFHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSL
VWILENDITPVLDHTFCVEHNAFGRILQHELKPNGRNVPVTEENKKEYVRLYVNWRFMRG
IEAQFLALQKGFNELIPQHLLKPFDQKELELIIGGLDKIDLNDWKSNTRLKHCVADSNIV
RWFWQAVETFDEERRARLLQFVTGSTRVPLQGFKALQGSTGAAGPRLFTIHLIDANTDNL
PKAHTCFNRIDIPPYESYEKLYEKLLTAVEETCGFAVE
|
|
|
|---|
| BDBM239122 |
|---|
| n/a |
|---|
| Name | BDBM239122 |
|---|
| Synonyms: | US10195181, Example 12 | US9403810, 12 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H40N4O5 |
|---|
| Mol. Mass. | 488.6196 |
|---|
| SMILES | CO[C@@H]1C[C@H](O[C@H](C1)C(C)(C)C)c1onc(C(=O)Nc2c(C)n(C)n(C3CCCCC3)c2=O)c1C |
|---|
| Structure | 
|
|---|
Search and Browse
