| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Metallo-beta-lactamase type 2 |
|---|
| Ligand | BDBM361068 |
|---|
| Substrate/Competitor | n/a |
|---|
| IC50 | 0.026±n/a nM |
|---|
| Citation |  Bennett, F; Jiang, J; Pasternak, A; Dong, S; Gu, X; Scott, JD; Tang, H; Zhao, Z; Huang, Y; Yang, D; Young, K; Xiao, L; Zhang, Z; Fu, J Metallo-beta-lactamase inhibitors US Patent US10544130 Publication Date 1/28/2020 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Metallo-beta-lactamase type 2 |
|---|
| Name: | Metallo-beta-lactamase type 2 |
|---|
| Synonyms: | B2 metallo-beta-lactamase | BLAN1_KLEPN | Beta-lactamase NDM-1 | Beta-lactamase type II | Metallo-beta-lactamase NDM-1 | Metallo-beta-lactamase type 2 | Metallo-beta-lactamase type II | NDM-1 | New Delhi metallo-beta-lactamase-1 | blaNDM-1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 28498.15 |
|---|
| Organism: | Klebsiella pneumoniae |
|---|
| Description: | ChEMBL_103887 |
|---|
| Residue: | 270 |
|---|
| Sequence: | MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQ
HTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTH
AHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPL
KVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAF
PKASMIVMSHSAPDSRAAITHTARMADKLR
|
|
|
|---|
| BDBM361068 |
|---|
| n/a |
|---|
| Name | BDBM361068 |
|---|
| Synonyms: | (R)-N4-(pyrrolidin-3-yl)-2-(2H- tetrazol-5-yl)-3'-(1H-1,2,4-triazol-3- yl)-[1,1'-biphenyl]-3,4-disulfonamide | US10221163, Example 225 | US10544130, Example 225 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H20N10O4S2 |
|---|
| Mol. Mass. | 516.557 |
|---|
| SMILES | NS(=O)(=O)c1c(ccc(-c2cccc(c2)-c2nc[nH]n2)c1-c1nn[nH]n1)S(=O)(=O)N[C@@H]1CCNC1 |
|---|
| Structure | 
|
|---|
Search and Browse
