Reaction Details |
| Report a problem with these data |
Target | Complement factor D |
---|
Ligand | BDBM302867 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Factor D Assay |
---|
IC50 | <1000±n/a nM |
---|
Citation | Gadhachanda, VR; Hashimoto, A; Pais, G; Wang, Q; Chen, D; Wang, X; Agarwal, A; Deshpande, M; Wiles, JA; Phadke, AS Amino compounds for treatment of complement mediated disorders US Patent US9598446 Publication Date 3/21/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Complement factor D |
---|
Name: | Complement factor D |
Synonyms: | Adipsin | C3 convertase activator | CFAD_HUMAN | CFD | DF | PFD | Properdin factor D |
Type: | Protein |
Mol. Mass.: | 27039.19 |
Organism: | Homo sapiens (Human) |
Description: | P00746 |
Residue: | 253 |
Sequence: | MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
|
|
|
BDBM302867 |
---|
n/a |
---|
Name | BDBM302867 |
Synonyms: | (2S,4R)-1-(2-(3- acetyl-6- (trifluoromethylsulfon- amido)-1H-indol-1- yl)acetyl)-N-(3- chloro-2- fluorobenzyl)-4- fluoropyrrolidine-2- carboxamide | US10660876, Cmpd No. 2 | US9598446, Compound 2 |
Type | Small organic molecule |
Emp. Form. | C25H22ClF5N4O5S |
Mol. Mass. | 620.976 |
SMILES | CC(=O)c1cn(CC(=O)N2C[C@H](F)C[C@H]2C(=O)NCc2cccc(Cl)c2F)c2cc(NS(=O)(=O)C(F)(F)F)ccc12 |r,$;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;HN;;;;;;;;;;$| |
Structure |
|