Reaction Details |
| Report a problem with these data |
Target | Complement factor D |
---|
Ligand | BDBM302889 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Factor D Assay |
---|
IC50 | <1000±n/a nM |
---|
Citation | Gadhachanda, VR; Hashimoto, A; Pais, G; Wang, Q; Chen, D; Wang, X; Agarwal, A; Deshpande, M; Wiles, JA; Phadke, AS Amino compounds for treatment of complement mediated disorders US Patent US9598446 Publication Date 3/21/2017 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Complement factor D |
---|
Name: | Complement factor D |
Synonyms: | Adipsin | C3 convertase activator | CFAD_HUMAN | CFD | DF | PFD | Properdin factor D |
Type: | Protein |
Mol. Mass.: | 27039.19 |
Organism: | Homo sapiens (Human) |
Description: | P00746 |
Residue: | 253 |
Sequence: | MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
|
|
|
BDBM302889 |
---|
n/a |
---|
Name | BDBM302889 |
Synonyms: | 1-(2-((2S,4R)-2-(6- chloropyridin-2- ylcarbamoyl)-4- fluoropyrrolidin-1-yl)- 2-oxoethyl)-5- (pyrimidin-5- ylamino)-1H- indazole-3- carboxamide | US10660876, Cmpd No. 12 | US9598446, Compound 12 |
Type | Small organic molecule |
Emp. Form. | C24H21ClFN9O3 |
Mol. Mass. | 537.933 |
SMILES | NC(=O)c1nn(CC(=O)N2C[C@H](F)C[C@H]2C(=O)Nc2cccc(Cl)n2)c2ccc(Nc3cncnc3)cc12 |r| |
Structure |
|