| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Complement factor D |
|---|
| Ligand | BDBM303049 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Factor D Assay |
|---|
| IC50 | 5500±n/a nM |
|---|
| Citation |  Gadhachanda, VR; Hashimoto, A; Pais, G; Wang, Q; Chen, D; Wang, X; Agarwal, A; Deshpande, M; Wiles, JA; Phadke, AS Amino compounds for treatment of complement mediated disorders US Patent US9598446 Publication Date 3/21/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Complement factor D |
|---|
| Name: | Complement factor D |
|---|
| Synonyms: | Adipsin | C3 convertase activator | CFAD_HUMAN | CFD | DF | PFD | Properdin factor D |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 27039.19 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P00746 |
|---|
| Residue: | 253 |
|---|
| Sequence: | MHSWERLAVLVLLGAAACAAPPRGRILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQW
VLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQL
SEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCN
RRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEGVVTSGSRVCGNRKKPGIYTR
VASYAAWIDSVLA
|
|
|
|---|
| BDBM303049 |
|---|
| n/a |
|---|
| Name | BDBM303049 |
|---|
| Synonyms: | (2S,4R)-1-(2-(3- acetyl-5-(pyrimidin-5- ylamino)-1H-indol-1- yl)acetyl)-4-fluoro-N- (8-methoxy-6- methylchroman-4- yl)pyrrolidine-2- carboxamide | US10660876, Cmpd No. 54 | US9598446, Compound 54 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C32H33FN6O5 |
|---|
| Mol. Mass. | 600.64 |
|---|
| SMILES | COc1cc(C)cc2C(CCOc12)NC(=O)[C@@H]1C[C@@H](F)CN1C(=O)Cn1cc(C(C)=O)c2cc(Nc3cncnc3)ccc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
