| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Programmed cell death 1 ligand/protein 1 |
|---|
| Ligand | BDBM452150 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Biochemical Protein-Protein Interaction Assay |
|---|
| IC50 | 0.060±n/a nM |
|---|
| Citation |  Aktoudianakis, E; Cho, A; Du, Z; Graupe, M; Lad, LT; Machicao Tello, PA; Medley, JW; Metobo, SE; Mukherjee, PK; Naduthambi, D; Parkhill, EQ; Phillips, BW; Simonovich, SP; Squires, NH; Wang, P; Watkins, WJ; Xu, J; Yang, KS; Ziebenhaus, CA PD-1/PD-L1 inhibitors US Patent US11555029 Publication Date 1/17/2023 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Programmed cell death 1 ligand/protein 1 |
|---|
| Name: | Programmed cell death 1 ligand/protein 1 |
|---|
| Synonyms: | PD-1/PD-L1 | Programmed cell death protein 1/Programmed cell death 1 ligand 1 |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Programmed cell death protein 1 |
|---|
| Synonyms: | CD_antigen=CD279 | PD1 | PDCD1 | PDCD1_HUMAN | Programmed cell death protein 1 | Protein PD-1 | hPD-1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 31650.07 |
|---|
| Organism: | Homo sapiens |
|---|
| Description: | ChEMBL_108437 |
|---|
| Residue: | 288 |
|---|
| Sequence: | MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTS
ESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGT
YLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGS
LVLLVWVLAVICSRAARGTIGARRTGQPLKEDPSAVPVFSVDYGELDFQWREKTPEPPVP
CVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPEDGHCSWPL
|
|
|
|---|
| Component 2 |
| Name: | Programmed cell death 1 ligand 1 |
|---|
| Synonyms: | B7 homolog 1 | B7-H1 | B7H1 | B7H1 | CD274 | CD_antigen=CD274 | PD-L1 | PD1L1_HUMAN | PDCD1 ligand 1 | PDCD1L1 | PDCD1LG1 | PDL1 | Programmed cell death 1 ligand 1 | Programmed death ligand 1 |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 33278.49 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | ChEMBL_109807 |
|---|
| Residue: | 290 |
|---|
| Sequence: | MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNERTH
LVILGAILLCLGVALTFIFRLRKGRMMDVKKCGIQDTNSKKQSDTHLEET
|
|
|
|---|
| BDBM452150 |
|---|
| n/a |
|---|
| Name | BDBM452150 |
|---|
| Synonyms: | US10710986, Example 289 | US11555029, No. 289 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C35H37Cl2N7O4 |
|---|
| Mol. Mass. | 690.619 |
|---|
| SMILES | COc1nc(cnc1CNC[C@@H]1CCC(=O)N1)-c1cccc(c1Cl)-c1cccc(c1Cl)-c1cnc(CN2CC3(CC(O)C3)C2)c(OC)n1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
