Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [489-587,Q496K] |
---|
Ligand | BDBM9151 |
---|
Substrate/Competitor | HIV Protease Peptide Substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 5.5±n/a |
---|
Temperature | 303.15±n/a K |
---|
IC50 | 0.02±n/a nM |
---|
Citation | Zhang, F; Chapman, KT; Schleif, WA; Olsen, DB; Stahlhut, M; Rutkowski, CA; Kuo, LC; Jin, L; Lin, JH; Emini, EA; Tata, JR The design, synthesis and evaluation of novel HIV-1 protease inhibitors with high potency against PI-resistant viral strains. Bioorg Med Chem Lett13:2573-6 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [489-587,Q496K] |
---|
Name: | Dimer of Gag-Pol polyprotein [489-587,Q496K] |
Synonyms: | HIV-1 Protease | HIV-1 Protease NL4-3 | HIV-1 protease wild-type |
Type: | Protein Complex |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [489-587,Q496K] |
Synonyms: | HIV-1 Protease Chain A | HIV-1 Protease NL4-3 | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10823.26 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587,Q496K] |
Residue: | 99 |
Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [489-587,Q496K] |
Synonyms: | HIV-1 Protease Chain A | HIV-1 Protease NL4-3 | POL_HV1N5 | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10823.26 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P12497[489-587,Q496K] |
Residue: | 99 |
Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM9151 |
---|
HIV Protease Peptide Substrate |
---|
Name: | HIV Protease Peptide Substrate |
Synonyms: | HIV Protease Substrate |
Type: | Peptide |
Mol. Mass.: | 2715.95 |
Organism: | n/a |
Description: | n/a |
Residue: | 25 |
Sequence: | VSQN-(beta-naphthylalanine)-PIV
|
|
|