| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Mitogen-activated protein kinase 14 |
|---|
| Ligand | BDBM15414 |
|---|
| Substrate/Competitor | biotinylated GST-ATF2 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| pH | 7.2±n/a |
|---|
| Temperature | 303.15±n/a K |
|---|
| IC50 | 5±0.5 nM |
|---|
| Citation |  McClure, KF; Abramov, YA; Laird, ER; Barberia, JT; Cai, W; Carty, TJ; Cortina, SR; Danley, DE; Dipesa, AJ; Donahue, KM; Dombroski, MA; Elliott, NC; Gabel, CA; Han, S; Hynes, TR; Lemotte, PK; Mansour, MN; Marr, ES; Letavic, MA; Pandit, J; Ripin, DB; Sweeney, FJ; Tan, D; Tao, Y Theoretical and experimental design of atypical kinase inhibitors: application to p38 MAP kinase. J Med Chem48:5728-37 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Mitogen-activated protein kinase 14 |
|---|
| Name: | Mitogen-activated protein kinase 14 |
|---|
| Synonyms: | CSAID-binding protein | CSBP | CSBP1 | CSBP2 | CSPB1 | Cytokine suppressive anti-inflammatory drug-binding protein | MAP kinase 14 | MAP kinase MXI2 | MAP kinase p38 alpha | MAPK 14 | MAPK14 | MAX-interacting protein 2 | MK14_HUMAN | MXI2 | Mitogen-activated protein kinase p38 alpha | SAPK2A | Stress-activated protein kinase 2a | p38 MAP kinase alpha/beta |
|---|
| Type: | Serine/threonine-protein kinase |
|---|
| Mol. Mass.: | 41286.76 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q16539 |
|---|
| Residue: | 360 |
|---|
| Sequence: | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
|
|
|
|---|
| BDBM15414 |
|---|
| biotinylated GST-ATF2 |
|---|
| Name: | biotinylated GST-ATF2 |
|---|
| Synonyms: | ATF-2-GST | ATF2 | Activating transcription factor 2 | Activating transcription factor 2-GST fusion | GST-ATF2 | biotinylated ATF2 substrate | biotinylated activating transcription factor 2 |
|---|
| Type: | Other Protein Type |
|---|
| Mol. Mass.: | 12237.77 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 109 |
|---|
| Sequence: | MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKN
CEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPS
|
|
|
|---|
Search and Browse
