Reaction Details |
| Report a problem with these data |
Target | Cathepsin D |
---|
Ligand | BDBM16056 |
---|
Substrate/Competitor | Cathepsin D Peptide Substrate |
---|
Meas. Tech. | Enzyme Inhibition Measurements |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 60±n/a nM |
---|
Comments | extracted |
---|
Citation | Hanessian, S; Yun, H; Hou, Y; Yang, G; Bayrakdarian, M; Therrien, E; Moitessier, N; Roggo, S; Veenstra, S; Tintelnot-Blomley, M; Rondeau, JM; Ostermeier, C; Strauss, A; Ramage, P; Paganetti, P; Neumann, U; Betschart, C Structure-based design, synthesis, and memapsin 2 (BACE) inhibitory activity of carbocyclic and heterocyclic peptidomimetics. J Med Chem48:5175-90 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Cathepsin D |
---|
Name: | Cathepsin D |
Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
Type: | Enzyme |
Mol. Mass.: | 44551.72 |
Organism: | Homo sapiens (Human) |
Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
Residue: | 412 |
Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
BDBM16056 |
---|
Cathepsin D Peptide Substrate |
---|
Name: | Cathepsin D Peptide Substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 2375.29 |
Organism: | n/a |
Description: | Peptide substrates were obtained from Bachem (Bubendorf, Switzerland). |
Residue: | 20 |
Sequence: | Mca-GKPILFFRLK(DNP)-D-R-NH2
|
|
|