Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 14
LigandBDBM19440
Substrate/CompetitorEGF receptor peptide
Meas. Tech.p38 Enzyme Assay.
pH7.5±n/a
Temperature303.15±n/a K
IC50 12±n/a nM
CommentsLPS-induced TNF production in rat (rLPS), inhibition @ 20 mpk =96 %.
Citation Graneto MJKurumbail RGVazquez MLShieh HSPawlitz JLWilliams JMStallings WCGeng LNaraian ASKoszyk FJStealey MAXu XDWeier RMHanson GJMourey RJCompton RPMnich SJAnderson GDMonahan JBDevraj R Synthesis, Crystal Structure, and Activity of Pyrazole-Based Inhibitors of p38 Kinase. J Med Chem 50:5712-9 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Mitogen-activated protein kinase 14
Name:Mitogen-activated protein kinase 14
Synonyms:CSAID-binding protein | CSBP | Cytokine suppressive anti-inflammatory drug-binding protein | MAP Kinase p38 alpha | MAP kinase MXI2 | MAP kinase p38 | MAX-interacting protein 2 | Mitogen-activated protein kinase (MAP) p38 alpha | Mitogen-activated protein kinase (Map p38 alpha) | Mitogen-activated protein kinase 14 (MAP kinase p38 alpha) | Mitogen-activated protein kinase 14 (MAPK14 p38 alpha) | Mitogen-activated protein kinase 14 (MAPK14) | Mitogen-activated protein kinase 14 (MAPK14) (p38 MAPKa) | Mitogen-activated protein kinase 14 (MAPK14) (p38 MAPKÿ±) | Mitogen-activated protein kinase 14 (p38 MAPKa) | Mitogen-activated protein kinase 14 (p38 alpha) | Mitogen-activated protein kinase 14, activated protein kinase p38 alpha | Mitogen-activated protein kinase p38 alpha | Mitogen-activated protein kinase p38 alpha (p38 MAPKa) | SAPK2A | p38-alpha
Type:Serine/threonine-protein kinase
Mol. Mass.:41286.76
Organism:Homo sapiens (Human)
Description:n/a
Residue:360
Sequence:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19440
EGF receptor peptide
Name:EGF receptor peptide
Synonyms:Epidermal Growth Factor Receptor Peptide (EGFRP)
Type:Peptide
Mol. Mass.:2318.63
Organism:n/a
Description:n/a
Residue:21
Sequence:
KRELVEPLTPSGEAPNQALLR