Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRibosomal protein S6 kinase alpha 5
LigandBDBM24991
Substrate/CompetitorFluorescent-labeled Crosstide
Meas. Tech.In Vitro Kinase Inhibition Assay
IC50 3±n/a nM
Citation Heerding DARhodes NLeber JDClark TJKeenan RMLafrance LVLi MSafonov IGTakata DTVenslavsky JWYamashita DSChoudhry AECopeland RALai ZSchaber MDTummino PJStrum SLWood ERDuckett DREberwein DKnick VBLansing TJMcConnell RTZhang SMinthorn EAConcha NOWarren GLKumar R Identification of 4-(2-(4-amino-1,2,5-oxadiazol-3-yl)-1-ethyl-7-{[(3S)-3-piperidinylmethyl]oxy}-1H-imidazo[4,5-c]pyridin-4-yl)-2-methyl-3-butyn-2-ol (GSK690693), a novel inhibitor of AKT kinase. J Med Chem 51:5663-79 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Ribosomal protein S6 kinase alpha 5
Name:Ribosomal protein S6 kinase
Synonyms:90 kDa ribosomal protein S6 kinase 5 | Mitogen- and Stress-Activated Protein Kinase 1 (MSK1) | Nuclear mitogen- and stress-activated protein kinase 1 | Nuclear mitogen- and stress-activated protein kinase 1 (MSK1) | RPS6KA5(Kin.Dom.2 - C-terminal) | RSK-like protein kinase | RSKL | Ribosomal protein S6 kinase alpha-5
Type:Serine/threonine-protein kinase
Mol. Mass.:89874.44
Organism:Homo sapiens (Human)
Description:n/a
Residue:802
Sequence:
MEEEGGSSGGAAGTSADGGDGGEQLLTVKHELRTANLTGHAEKVGIENFELLKVLGTGAY
GKVFLVRKISGHDTGKLYAMKVLKKATIVQKAKTTEHTRTERQVLEHIRQSPFLVTLHYA
FQTETKLHLILDYINGGELFTHLSQRERFTEHEVQIYVGEIVLALEHLHKLGIIYRDIKL
ENILLDSNGHVVLTDFGLSKEFVADETERAYSFCGTIEYMAPDIVRGGDSGHDKAVDWWS
LGVLMYELLTGASPFTVDGEKNSQAEISRRILKSEPPYPQEMSALAKDLIQRLLMKDPKK
RLGCGPRDADEIKEHLFFQKINWDDLAAKKVPAPFKPVIRDELDVSNFAEEFTEMDPTYS
PAALPQSSEKLFQGYSFVAPSILFKRNAAVIDPLQFHMGVERPGVTNVARSAMMKDSPFY
QHYDLDLKDKPLGEGSFSICRKCVHKKSNQAFAVKIISKRMEANTQKEITALKLCEGHPN
IVKLHEVFHDQLHTFLVMELLNGGELFERIKKKKHFSETEASYIMRKLVSAVSHMHDVGV
VHRDLKPENLLFTDENDNLEIKIIDFGFARLKPPDNQPLKTPCFTLHYAAPELLNQNGYD
ESCDLWSLGVILYTMLSGQVPFQSHDRSLTCTSAVEIMKKIKKGDFSFEGEAWKNVSQEA
KDLIQGLLTVDPNKRLKMSGLRYNEWLQDGSQLSSNPLMTPDILGSSGAAVHTCVKATFH
AFNKYKREGFCLQNVDKAPLAKRRKMKKTSTSTETRSSSSESSHSSSSHSHGKTTPTKTL
QPSNPADSNNPETLFQFSDSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM24991
Fluorescent-labeled Crosstide
Name:Fluorescent-labeled Crosstide
Synonyms:5(6)-Carboxytetramethylrhodamine-labeled peptide | TAMRA-labeled peptide
Type:Fluorescent dye labeled peptide
Mol. Mass.:1165.24
Organism:n/a
Description:n/a
Residue:11
Sequence:
GRPRTSSFAEG